From: Bob Margolis Subject: (fractint) Fractal Geometry Summer Workshop Date: 01 Nov 2000 04:59:20 -0600 Roger Bagula posted the following URL to a couple of the fractal newsgroups. It may be of interest to the newbies amongst us who want to know the mechanics behind the Mandelbrot and Julia Sets. Bob ========== Introduction to Fractal Geometry Yale University, August 2000. Michael Frame and Benoit Mandelbrot http://classes.yale.edu/99-00/math190a/index.html Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) FOTD 01-11-00 (Old Gold Minibrot [4]) Date: 01 Nov 2000 07:26:45 -0500 (EST) FOTD -- November 01, 2000 (Rating 5) Fractal visionaries and enthusiasts: I'm posting this at 7:15am because last evening both internet providers were inaccessible. This afternoon, (October 31), while browsing the fine selection of fractals posted to A.B.P.F., I wondered whether such images can honestly be called fractals. Then, realizing how the idea of what constitutes a fractal has changed in recent years, I wondered whether the old-fashioned style images I post in the FOTD can still be called fractals. Since the nature of the two styles of images is so different, I doubt that both can still be considered fractals. The images I create are done more in fun than with creative effort, usually involving little more than flat iteration bands and an adequate color palette. Sometimes the time from boot-up to completed image is less than 15 minutes. Except for the CPU speed increase, this is the same way I worked with fractals 10 years ago. But in that time, fractal programs have changed. They have evolved into virtual graphic programs. This is good, for it gives the fractalist much additional creative opportunity, albeit at the expense of that vague and debatable ideal, fractal purity. However, I feel that we have reached the point where fractal art has become so far removed from the original idea of fractals that the two can no longer be considered the same thing. This in no way reduces my opinion of the more artistic images, but I feel that some distinction must be made between the type of images I create and the type of images that appear on A.B.P.F. Since the more artistic fractalists remain satisfied calling the images they produce fractals, I will change the description of my images from fractals to classic fractals. The appearance of the images themselves, as well as the discussion will remain unchanged. As a simple example, today's image explores the fractal that results when the expression Z^(-14)+2.5Z^(-1.45)+(1/C) is iterated. I named it "The Lost Minibrot" because that title seemed poetic, and not because I lost it, which obviously is not the case. The picture rates a perfectly average 5. The parameter file renders in a dragging 14 minutes, making a download of the GIF image file from: or from: the far wiser choice. The fractal weather today (Halloween) was perfect, and the cats took full advantage of the perfection. In the 61F (16C) degree air they romped and frolicked until they exhausted themselves, a time which is quite short for gloriously middle-aged classic fractal cats. I'll return tomorrow, (now later today), with another classic fractal and more words of wisdom. Until then, take care, and regardless of what you call them, keep those fractals coming. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ The_Lost_Minibrot { ; time=0:17:02.17 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+1.85728145477441900/-0.23424119516995760\ /5531863/1/162.499 params=1/-14/2.5/-1.45/0/0 float=y maxiter=1800 inside=0 logmap=204 periodicity=10 colors=000X4A_5A_7A_8A<3>dEAfGAgHAhJAjIAlK9lL8lM7<9>\ RF2OE2MD1<2>GB0EB0DC1<32>7eK7fL6gL<3>6jN<13>bqfdrhgr\ i<2>ntnptoqqprtprjmrjjq`gq_dqUaqQ_<19>cmAco9bp8<3>`t\ 3<39>OGKOFKOEL<2>NBMNAMOBN<9>ODXODYODZOE_OE`<9>ONiOO\ jOPk<2>OSnNTpOUn<3>OYjPZiP_hP`gPaf<3>_ebbfaeg`hi_<3>\ ttWwwVzzU<18>zzBzzAzz9<2>zz7zz6zz6zz6<3>zz7 } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "=?Windows-1252?B?UHVza+FzIElzdHbhbiBqci4=?=" Subject: Midgets - Re: (fractint) FOTD 29-10-00 (The Green Goblet [5]) Date: 01 Nov 2000 22:34:02 +0100 >What is necessary for an image to have midgets? should the power o Z be >greater than 2?? Are 'midgets' the smaller Mandelbrot-shapes in the main Mandelbrot-set and the small 'clones' in other sets? If yes: I think that the iteration should be trapped with some starting values (the value of 'Z' should settle to a low value, instead of increasing toward infinity). The Mandelbrot-set and the 'connected' Julia-sets have this behaviour, the 'unconnected' Julia-sets and some other formulas - type=sierpinski, type=unity - don't. This may depend on the exponent in use for some formulas. Sorry for posting this so late, I forgot to send it. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Subject: Re: Midgets - Re: (fractint) FOTD 29-10-00 (The Green Goblet [5]) Date: 02 Nov 2000 15:01:10 +1300 =?Windows-1252?B?UHVza+FzIElzdHbhbiBqci4=?= (if that is the writer's name) said: > >What is necessary for an image to have midgets? should the power o Z be > >greater than 2?? > In the dynamic? As in z^2+c? I guess you mean "greater than or equal to 2". Lemme just switch to Fractint for a sec... Well, I found a recognisable Mandelbrot midget - a slightly nicked z^2+c-like one - in z^1.9+c. > Are 'midgets' the smaller Mandelbrot-shapes in the main Mandelbrot-set and > the small 'clones' in other sets? > Yes; also called "minibrots" or sometimes "atoms". > If yes: > I think that the iteration should be trapped with some starting values (the > value of 'Z' should settle to a low value, instead of increasing toward > infinity). The Mandelbrot-set and the 'connected' Julia-sets have this > behaviour, the 'unconnected' Julia-sets and some other formulas - > type=sierpinski, type=unity - don't. This may depend on the exponent in use > for some formulas. > The Mandelbrot Set and its Julia sets are defined by this property (z's being bounded in magnitude): points within the set lead to bounded orbits, orbits starting from points outside diverge towards infinity. In "unconnected" Julias (or "dusts"), the set is - what topologists would call - of measure zero, which is to say that the points of the set are isolated from each other. At any finite resolution, therefore, all you see are points _outside_ the set. In the Unity fractal, the set is the unit circle (hence the name): the fractal fun & games is a consquence of the method for finding it. I leave Sierpinski's gasket as an exercise for the reader. None of this really helps in determining when (and where) midgets should occur: the question gets even harder when you consider that some of these midgets (an infinite number, in fact - nay, the vast majority) are so badly distorted that they're often unrecognisable. Morgan L. Owens "Lesser fleas." Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "David Jones" Subject: Re: (fractint) Fractal Geometry Summer Workshop Date: 01 Nov 2000 18:38:37 -1000 The book "Turbulent Mirror" has a very good discussion and explanation of fractals that would be very good for newbies to fractals. On 1 Nov 00 at 4:59, Bob Margolis wrote: > Roger Bagula posted the following URL to a couple of the > fractal newsgroups. It may be of interest to the newbies > amongst us who want to know the mechanics behind the > Mandelbrot and Julia Sets. Another blast of bits from David http://home.hawaii.rr.com/aliasjj/ http://www.hawastsoc.org/ For the best Hawaii & Pacific Basin surf forecast: http://www.surfreporthawaii.com Random Thought for this Nanosecond Sorry - insufficient processing power. Upgrade brain (y) (n)? (D.Jones) Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "David Jones" Subject: Re: (fractint) FOTD 01-11-00 (Old Gold Minibrot [4]) Date: 01 Nov 2000 18:38:36 -1000 On 1 Nov 00 at 7:26, Jim Muth wrote: > Since the more artistic fractalists remain satisfied > calling the images they produce fractals, I will > change the description of my images from fractals to > classic fractals. Wrong choice. *real* fractals. IMHO, fractal images using layering et al - whether or not the layering is done in the fractal generator or in a separate program - are post-processed, and no longer fractals to me. Another blast of bits from David http://home.hawaii.rr.com/aliasjj/ http://www.hawastsoc.org/ For the best Hawaii & Pacific Basin surf forecast: http://www.surfreporthawaii.com Random Thought for this Nanosecond Observe with the eyes; work with the hands. (D.Jones) Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) Classic FOTD 02-11-00 (Meteor Impact [6]) Date: 02 Nov 2000 00:25:51 -0500 (EST) Classic FOTD -- Nov. 02, 2000 (Rating 6) Fractal visionaries and enthusiasts: I hope I've got everything right tonight. Last night, when I tried to post my FOTD, I found both Mindspring (Earthlink) and AOL inaccessible. Finally, early this morning, when I gained access, I forgot to update the image name. But no harm done -- the image wasn't that good anyway. Today's image is better, at least good enough to rate a somewhat above average 6. The brilliant object in the picture reminds me of a meteor plunging through earth's atmosphere on its way to a surface impact, which is why I named the image "Meteor Impact". The actual meteor is a midget in a remote part of the Z^1.195+C fractal. And I did touch up the colors in a graphic program. When I run the image through a graphic program, I never change it so much that it cannot be defined in a parameter file, so running the parameter file will produce exactly the same image as has been posted to: and to: The fractal weather was perfectly perfect all day, with a temperature of 62F (16.5C) and not a single cloud to mar the deep blue sky. The fractal cats showed approval by lounging in the yard for several hours, trying to decide what trouble to get into. My philosophical muse has been absent ever since I lost that long FOTD article a few nights ago. I'm hoping she'll return before too long. Until tomorrow, take care, and be good, but not too good. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Meteor_Impact { ; time=0:12:00.00 -- SF5 on a p200 reset=2001 type=formula formulafile=branchct.frm formulaname=MandelbrotBC passes=1 center-mag=-2.72959302366478800/+9.28940913170944800\ /74.45881/1/90 params=1.195/0/4.671/0 float=y maxiter=75000 inside=255 logmap=22 periodicity=10 colors=000B00B00E00G00H00L00M00P00R00U00V00X00_00_00\ b00b00d00<2>e00e00g00<2>h00h10j10<2>k10k10m20n20n40p\ 40p40q60q60r60t70t70v90v90w90wB0yB0zB0zD0<2>zE1zE1zG\ 2zG2zG4zH4zH6zJ6zJ6zJ7zL7zL9zL9zMBzMBzL7zMB<3>zMHzMJ\ zOM<3>zOSzOUzPX<3>zPbzPdzPezRhyRjyRkwRmwRnvRpvSrtStt\ SvrSwrSyqSzqUzpUzpUznUznUzmUzqMzmUzhazdhyakrXkkSkePk\ _RkYSkYUkXVkXXkVYkVYkR<2>bkadkddkg<3>jkrJkm<2>apzgqz\ mrzrtzyvzzwzzyz<23>zzyzzyzzy<3>zzyzzzzzyzzvzzrzzpzzk\ zzhzzezzbzzYzzVzzSzzPzzLzzHzzEzzBzz6zz2zz0zz0zz0zz2z\ z4zz4zz4zz4zz6zz6zz6wz6tz7qz7pz7mz7kz7kz9<2>kz9nzBqz\ BtzBwzBzzDzzDzzDzzDzzBzzD<5>zzEzzEzzEzzG<6>zzHzzHzzJ\ <2>zzJzzJzzL<6>zzMzzMzzO<3>zzOzzSzzz } frm:MandelbrotBC = { ; Z = Z^E + C e=p1 p=real(p2)+PI q=2*PI*trunc(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z|<100 } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Ralph Feltens Subject: Re: (fractint) FOTD 01-11-00 (Old Gold Minibrot [4]) Date: 02 Nov 2000 13:27:53 +0100 Hi there

I'm just another one of those people that after years of using fractint were lured to Ultrafractal and its layering capabilities. IMO, layering per se is not a sufficient reason to reject the resulting picture as not being a fractal any more. For as long as you are using the same formula and coordinates for all of the layers, the underlying fractal shape will stay invariant.

The use of different coloring (& layering) algorithms, of course, can lead to remarkably diverse results. But if you felt so inclined, you would still be able to reproduce the fractal by using a single coloring algorithm (probably a quite complex one) in a single layer image à la fractint (missing true color support or other limitations that are program- but not fractal-specific not being taken into consideration). So the use of layering techniques should not be irreconcilable with "fractal purism".

There are always some arbitrary choices to be made when generating a fractal, even a simple one in fractint: choice of colormap, spread of the colormap (e.g. log mapping), bailout radius (effects the position of the color bands). Not to speak of the choices nessessary to generate one of the beautiful orbit type fractals made popular by Paul Carlson ...

Regards

Ralph Feltens

PS. Somebody on this list (was it Jim Muth?) already stated the fact that all we see is not a fractal, but the image of a fractal ...

David Jones wrote:

On  1 Nov 00 at 7:26, Jim Muth wrote:

> Since the more artistic fractalists remain satisfied
> calling the images they produce fractals, I will
> change the description of my images from fractals to
> classic fractals.

Wrong choice. *real* fractals. IMHO, fractal images using
layering et al - whether or not the layering is done in
the fractal generator or in a separate program - are
post-processed, and no longer fractals to me.

Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Subject: Re: (fractint) FOTD 01-11-00 (Old Gold Minibrot [4]) Date: 03 Nov 2000 12:16:44 +1300 Ralph Feltens said: >

There are always some arbitrary choices to be made when generating a > fractal, even a simple one in fractint: choice of colormap, spread of the > colormap (e.g. log mapping), bailout radius (effects the position of the > color bands). Not to speak of the choices nessessary to generate one of > the beautiful orbit type fractals made popular by Paul > Carlson ... > Having seen some of the par files that Ultra Fractal uses, it seems that "arbitrary choices" make up the vast bulk of the task - layering/compositing, colouring, etc., but where's the fractal declared? Morgan L. Owens "The Gimp uses smaller scripts" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Fernando Bresslau" Subject: Re: Midgets - Re: (fractint) FOTD 29-10-00 (The Green Goblet [5]) Date: 02 Nov 2000 23:41:03 -0200 Thanks for the answers. yes, I was meaning the small mandelbrot copies in the z^something + c fractal. Actually, the mandelbrotmix4, which is a generalization of the previous formula. It happens sometimes that you hit on a fractal (by choosing the exponents and multipliers in the formula) that has lots of midgets quite visible and obvious. Other times that´s isn´t true. In some cases you get an unconnected set, others the seems to be conected, but hasn´t midgets, not even deformed ones. the mm4 formula is nice because it initializes the pixels (I think) in a way that we get undeformed midgets. So the question was which is the condition to the existence of midgets (even deformed ones) and I add now another one: when does a set get diconected? maybe it would be good to concentrate the analysis to the mm4 formula, which is namely z=k*((a*(z^b))+(d*(z^f)))+c being k, a, b, c, f the parameters at the z screen. Tahnks, Fernando Bresslau ----- Original Message ----- Sent: Thursday, November 02, 2000 12:01 AM > =?Windows-1252?B?UHVza+FzIElzdHbhbiBqci4=?= (if that is the writer's name) > said: > > >What is necessary for an image to have midgets? should the power o Z be > > >greater than 2?? > > > In the dynamic? As in z^2+c? I guess you mean "greater than or equal to 2". > Lemme just switch to Fractint for a sec... > > Well, I found a recognisable Mandelbrot midget - a slightly nicked z^2+c-like > one - in z^1.9+c. > > > Are 'midgets' the smaller Mandelbrot-shapes in the main Mandelbrot-set and > > the small 'clones' in other sets? > > > Yes; also called "minibrots" or sometimes "atoms". > > > If yes: > > I think that the iteration should be trapped with some starting values (the > > value of 'Z' should settle to a low value, instead of increasing toward > > infinity). The Mandelbrot-set and the 'connected' Julia-sets have this > > behaviour, the 'unconnected' Julia-sets and some other formulas - > > type=sierpinski, type=unity - don't. This may depend on the exponent in use > > for some formulas. > > > The Mandelbrot Set and its Julia sets are defined by this property (z's being > bounded in magnitude): points within the set lead to bounded orbits, orbits > starting from points outside diverge towards infinity. In "unconnected" Julias > (or "dusts"), the set is - what topologists would call - of measure zero, > which is to say that the points of the set are isolated from each other. At > any finite resolution, therefore, all you see are points _outside_ the set. > > In the Unity fractal, the set is the unit circle (hence the name): the fractal > fun & games is a consquence of the method for finding it. > > I leave Sierpinski's gasket as an exercise for the reader. > > None of this really helps in determining when (and where) midgets should > occur: the question gets even harder when you consider that some of these > midgets (an infinite number, in fact - nay, the vast majority) are so badly > distorted that they're often unrecognisable. > > Morgan L. Owens > "Lesser fleas." > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" _________________________________________________________ Do You Yahoo!? Get your free @yahoo.com address at http://mail.yahoo.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: (fractint) Re: Meteor Date: 02 Nov 2000 20:39:42 EST Cool image. I can hear the "disaster" music from Armageddon when I see it... _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: (fractint) A remark on fractal "purity" Date: 02 Nov 2000 20:43:45 EST Purity is clearly not a black and white distinction. Some would say that only the spare elegance of boundary scan/MIIM/distance estimator images are truly pure. Others include heavily post-processed images whenever the basic fractal image is enhanced rather than obfuscated or mutilated by the post-processing. I'd say it's a continuum, but that it's reasonably pure as long as the basic fractal is clear -- for example in some of the images I've experimented with recently, including anti-aliased images (done by making large images in D&C mode and resampling in Corel Photo-Paint) and truecolor images (I make three separate greyscale images, with different logmap settings, and use Corel's Combine Channels option to merge them as the red, green, and blue components of the result). The results look pretty "pure" to me... _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) Classic FOTD 03-11-00 (Ionized Mandelbrot [7]) Date: 02 Nov 2000 23:33:38 -0500 (EST) Classic FOTD -- November 03, 2000 (Rating 7) Fractal visionaries and enthusiasts: Today's striking fractal was created by a rather unusual formula -0.002*(Z^1000)+0.02*(Z^(-2))+(1/C). The parameters were chosen entirely at random, as are the parameters for nearly all my fractals. I named the image "Ionized Mandelbrot" because of the fuzzy, purplish-blue aura around the midget, which reminds me of the ionized glow in a vacuum tube. Since the picture is better than the past few days' efforts, I rated it an above-average 7 on my 0-to-10 scale of fractal worth. A day or so ago, a message was posted to the Fractint list, asking what was necessary for a fractal to have midgets. The truth is that after working with the MandelbrotMix4 formula for over a year, I just don't know. To begin, it is difficult to define exactly what a midget is. Many fractals are filled with holes that I do not consider midgets. By a 'midget' I usually mean a tiny, often distorted, classic Mandelbrot shape embedded in a larger fractal. These tiny Mandelbrot shapes are sometimes called 'atoms'. The easiest answer would be that midgets are present in all fractals of the form Z^n+C, where 'n' is greater than 1 and Z is initialized at the critical point of the formula. But the midgets are almost impossible to find in fractals where 'n' is less than 1.2. As 'n' is increased to higher values, the midgets become easier to find, but ever less interesting, eventually degenerating into boring lopsided circles. The M-Mix4 formula automatically initializes Z to a critical point of the iterated formula, but not all formulae have midgets, and in many other fractals only certain limited parts have midgets. I have much more to discover about when and where midgets I'll return to the topic of midgets in a day or two. For now it's time to give a reminder that today's image takes 8 minutes to render from the parameter file, and only a minute or so to download from: or from: The fractal weather today was perfect, with sunny skies and a temperature of 68F (20C), which lured the fractal cats onto the porch and then into the yard, where they sampled the cat-mint plant. The philosophy is still sleeping, but I've got a few hours to go yet in my day. It's just enough time to find a fractal and catch up on the fractal-art list, which has suddenly come alive. Until tomorrow, take care, and do fractals exist as real objects, or are they mere thoughts -- or are they both? Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Ionized_Mandelbrot { ; time=0:08:08.58 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+7.625829827008553/+0.00937269972207/3.58\ 9962e+011/1/129.992/0.007 params=1/1000/-10/-2/-1.00\ 2/5000 float=y maxiter=1400 inside=0 logmap=168 periodicity=10 colors=000805A07C08D0CF0DG0FI0IJ0JL0L<5>L0eL0hL0k<3>\ L1yL2zL2zL4zLOzDUzKYz0az0hz0oz0pz0ps1np<2>FehJceO`a<\ 3>dPQhMOkJLnIOoGQpGTrFWsDZuDaxCdyCgzAiz8l<2>z7uy4lr1\ e<3>T0AM01G00I00J00J02L04M07M0AO0CO0FP0IQ0JQ0MS0PS0Q\ W0TZ0Vc1We4Zi5`l7apAdsCexDgzGizIkzJlzLn<3>yWevZcsaap\ dZngYkiVhlTeoQcrP`uMYxLWzJVvMVrPVnQTkTTgVTcYSZ`SWaSS\ dQOeQJhQGiPM`OQZMWYM`WQWV<3>lFPTLOQMPOOSLPVGSQDTOAVJ\ 7WG2ZD0`80a50c20hA0lI<2>0ya<2>0zv0zz0zz0zy0xy0py0iy0\ cy0Wy0Px0Ox<3>0Qx0Vr<3>0ha0lY0oT0sO0xJ0zF<2>0z10z00z\ 41zA4zGAzM<2>OydSviWuh`xg<3>pnauk`yhZzF0<2>n1Mi0Ve0a\ c0hh0en4csC`xJYzQVzYSzdQ<2>zhOziOzkM<2>yoLvpMsrOrsPo\ uQlvSkxThyTgzVdzWazY`zZYz`Wz`szGzz0zz1zz5zzAzzFzzI<2\ >yzVvzYuzarzepziozlrzh<3>xzSyzOzzJ<3>zz14z05z17z2 } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Baerbel Strauch" Date: 03 Nov 2000 08:42:35 CET hi there, i´m a big admirer of the fractal-art and i love your page...i would like to know: is there a beginners manual for working with/on fractals; some explanations , photographs, webpages... i´m also intetested in books. i´d love to create my own fractals! thank u, bärbel _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul N. Lee" Subject: (fractint) Re: Date: 03 Nov 2000 01:56:51 -0600 Bärbel Strauch wrote: > > hi there, > i´m a big admirer of the fractal-art and i love > your page...i would like to know: > is there a beginners manual for working with/on > fractals; some explanations, photographs, webpages... > i´m also intetested in books. > i´d love to create my own fractals! > thank u, > +++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ SHORT AND SIMPLE: The fractal related newsgroups, discussion lists, and websites get a lot of requests regarding fractal information. The following is by no means an exhaustive listing. (For the exhaustive list see the next section of this document.) Just below is a listing of a few of the programs (some freeware; some shareware) frequently used by persons posting to the newsgroup. Flarium/Iterations/Tiera-Zon/Sterling-ware/and others.... http://www.eclectasy.com/Iterations-et-Flarium24/ (mirror) http://www-hs.iuta.u-bordeaux.fr/ferguson/ Fractal ViZion/Fractal ZPlot/and others.... http://www.geocities.com/SoHo/Lofts/5601/ Fractint http://spanky.triumf.ca/www/fractint/ Fractal eXtreme http://www.cygnus-software.com/ Fractal Orbits 32 http://spanky.triumf.ca/pub/fractals/programs/ibmpc/windows/fo32201.zip UltraFractal http://www.ultrafractal.com/ For the MAC: FracPPC & Fractal Domains http://www.fractaldomains.com/ other MAC programs: http://hypertextbook.com/chaos/92.shtml http://spanky.triumf.ca/pub/fractals/programs/MAC/ http://iq.tvsoft.com/~dplatt/mac/ http://www.swin.edu.au/astronomy/pbourke/ +++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ For an exhaustive list of fractal generators, galleries featuring fractals, and other fractal related information, go to the following: http://home.att.net/~Paul.N.Lee/Fractal_Software.html and http://home.att.net/~Paul.N.Lee/Fractal_Links.txt and http://home.att.net/~Paul.N.Lee/Fractal_Census.html +++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ Sincerely, P.N.L. http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Fernando Bresslau" Subject: (fractint) Re: Date: 03 Nov 2000 10:08:02 -0200 Hi, Bärbel. I myself work mostly with two programs: fractint and Ultrafractal. Both of them have nice webpages, with lots of info, including for beginners. So I sugggest you take a look at www.fractint.org and www.ultrafractal.com where you will find links to downloads of the programs and to resources, tutorials and goodies for beginners. Thak you for your interest, Fernando Bresslau http://www.fractal.art.br ----- Original Message ----- Sent: Friday, November 03, 2000 6:42 AM > hi there, > i´m a big admirer of the fractal-art and i love your page...i would like to > know: > is there a beginners manual for working with/on fractals; some explanations > , photographs, webpages... i´m also intetested in books. > i´d love to create my own fractals! > thank u, > bärbel > _________________________________________________________________________ > Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. > > Share information about yourself, create your own public profile at > http://profiles.msn.com. > > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" _________________________________________________________ Do You Yahoo!? Get your free @yahoo.com address at http://mail.yahoo.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Fernando Bresslau" Subject: Re: (fractint) Classic FOTD 03-11-00 (Ionized Mandelbrot [7]) Date: 03 Nov 2000 10:17:19 -0200 Thanks, Jim, for the nice answer and for the nice midget... I´ll start iterating formulas with z´s bigger than 1.5, maybe a lot bigger, like 1e20... Fernando Bresslau http://www.fractal.art.br ----- Original Message ----- Cc: Sent: Friday, November 03, 2000 2:33 AM > > Classic FOTD -- November 03, 2000 (Rating 7) > > Fractal visionaries and enthusiasts: > > Today's striking fractal was created by a rather unusual formula > -0.002*(Z^1000)+0.02*(Z^(-2))+(1/C). The parameters were chosen > entirely at random, as are the parameters for nearly all my > fractals. > > I named the image "Ionized Mandelbrot" because of the fuzzy, > purplish-blue aura around the midget, which reminds me of the > ionized glow in a vacuum tube. Since the picture is better than > the past few days' efforts, I rated it an above-average 7 on my > 0-to-10 scale of fractal worth. > > A day or so ago, a message was posted to the Fractint list, > asking what was necessary for a fractal to have midgets. The > truth is that after working with the MandelbrotMix4 formula for > over a year, I just don't know. To begin, it is difficult to > define exactly what a midget is. Many fractals are filled with > holes that I do not consider midgets. By a 'midget' I usually > mean a tiny, often distorted, classic Mandelbrot shape embedded > in a larger fractal. These tiny Mandelbrot shapes are sometimes > called 'atoms'. > > The easiest answer would be that midgets are present in all > fractals of the form Z^n+C, where 'n' is greater than 1 and Z is > initialized at the critical point of the formula. But the > midgets are almost impossible to find in fractals where 'n' is > less than 1.2. As 'n' is increased to higher values, the > midgets become easier to find, but ever less interesting, > eventually degenerating into boring lopsided circles. > > The M-Mix4 formula automatically initializes Z to a critical > point of the iterated formula, but not all formulae have > midgets, and in many other fractals only certain limited parts > have midgets. I have much more to discover about when and where > midgets > > I'll return to the topic of midgets in a day or two. For now > it's time to give a reminder that today's image takes 8 minutes > to render from the parameter file, and only a minute or so to > download from: > > > > or from: > > > > The fractal weather today was perfect, with sunny skies and a > temperature of 68F (20C), which lured the fractal cats onto the > porch and then into the yard, where they sampled the cat-mint > plant. > > The philosophy is still sleeping, but I've got a few hours to go > yet in my day. It's just enough time to find a fractal and > catch up on the fractal-art list, which has suddenly come alive. > Until tomorrow, take care, and do fractals exist as real objects, > or are they mere thoughts -- or are they both? > > > Jim Muth > jamth@mindspring.com > > > START 20.0 PAR-FORMULA FILE================================ > > Ionized_Mandelbrot { ; time=0:08:08.58 -- SF5 on a P200 > reset=2001 type=formula formulafile=critical.frm > formulaname=MandelbrotMix4 function=recip passes=1 > center-mag=+7.625829827008553/+0.00937269972207/3.58\ > 9962e+011/1/129.992/0.007 params=1/1000/-10/-2/-1.00\ > 2/5000 float=y maxiter=1400 inside=0 > logmap=168 periodicity=10 > colors=000805A07C08D0CF0DG0FI0IJ0JL0L<5>L0eL0hL0k<3>\ > L1yL2zL2zL4zLOzDUzKYz0az0hz0oz0pz0ps1np<2>FehJceO`a<\ > 3>dPQhMOkJLnIOoGQpGTrFWsDZuDaxCdyCgzAiz8l<2>z7uy4lr1\ > e<3>T0AM01G00I00J00J02L04M07M0AO0CO0FP0IQ0JQ0MS0PS0Q\ > W0TZ0Vc1We4Zi5`l7apAdsCexDgzGizIkzJlzLn<3>yWevZcsaap\ > dZngYkiVhlTeoQcrP`uMYxLWzJVvMVrPVnQTkTTgVTcYSZ`SWaSS\ > dQOeQJhQGiPM`OQZMWYM`WQWV<3>lFPTLOQMPOOSLPVGSQDTOAVJ\ > 7WG2ZD0`80a50c20hA0lI<2>0ya<2>0zv0zz0zz0zy0xy0py0iy0\ > cy0Wy0Px0Ox<3>0Qx0Vr<3>0ha0lY0oT0sO0xJ0zF<2>0z10z00z\ > 41zA4zGAzM<2>OydSviWuh`xg<3>pnauk`yhZzF0<2>n1Mi0Ve0a\ > c0hh0en4csC`xJYzQVzYSzdQ<2>zhOziOzkM<2>yoLvpMsrOrsPo\ > uQlvSkxThyTgzVdzWazY`zZYz`Wz`szGzz0zz1zz5zzAzzFzzI<2\ > >yzVvzYuzarzepziozlrzh<3>xzSyzOzzJ<3>zz14z05z17z2 > } > > frm:MandelbrotMix4 {; Jim Muth > a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), > g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, > k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): > z=k*((a*(z^b))+(d*(z^f)))+c, > |z| < l > } > > END 20.0 PAR-FORMULA FILE================================== > > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" _________________________________________________________ Do You Yahoo!? Get your free @yahoo.com address at http://mail.yahoo.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Barry N. Merenoff" <110144.2274@compuserve.com> Subject: Midgets - Re: (fractint) FOTD 29-10-00 (The Green Goblet Date: 03 Nov 2000 13:38:24 -0500 Message text written by INTERNET:fractint@lists.xmission.com >I think that the iteration should be trapped with some starting values< That's an interesting idea. Could you please elaborate on it? Or maybe se= nd a sample Par? Sincerely, Collin Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Barry N. Merenoff" <110144.2274@compuserve.com> Subject: Re: Midgets - Re: (fractint) FOTD 29-10-00 (The Green Date: 03 Nov 2000 14:13:01 -0500 Message text written by INTERNET:fractint@lists.xmission.com >In "unconnected" Julias = (or "dusts"), the set is - what topologists would call - of measure zero,= = which is to say that the points of the set are isolated from each other.<= Not quite. A dust has a "topological dimension" of zero. A connected Juli= a has a topological dimension of one, and a fractal with a decorated interi= or has a topological dimension of two. Note that the topological dimension i= s always an integer, and is not the quantity usually referred to as dimension. That usual quantity is the Hausdorff dimension, which is alway= s greater than the topological dimension, and may be fractional. The measur= e of a fractal is in units of length to the power of the Hausdorff dimensio= n. For example, the Sierpinski Gasket has a topological dimension of 1 and a= Hausdorff dimension of 1.585. The measure is proportional to the 0.7925 power of the bounding triangle's area. The Mandelbrot Set, with a solid-color fill, has a topological dimension = of 1 and a Hausdorff dimension of 2, but its measure is zero. Because the topological dimension is 1, the measure includes only the boundary, not t= he interior. A Hausdorff dimension of 2 indicates that the measure is in ordinary units of area. This means that the boundary forms structures tha= t appear to be filled in with a boundary-only area, but which when magnifie= d are always seen to be merely a curve. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Barry N. Merenoff" <110144.2274@compuserve.com> Subject: Re: (fractint) Fractal Geometry Summer Workshop Date: 03 Nov 2000 14:19:46 -0500 Message text written by INTERNET:fractint@lists.xmission.com >The book "Turbulent Mirror" has a very good discussion = and explanation of fractals that would be very good for = newbies to fractals. < I thought "Turbulent Mirror" was too philosophical. "Fractals Everywhere"= sticks more to the subject. Sincerely, Collin Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Barry N. Merenoff" <110144.2274@compuserve.com> Subject: Re: (fractint) FOTD 01-11-00 (Old Gold Minibrot [4]) Date: 03 Nov 2000 14:27:57 -0500 Message text written by INTERNET:fractint@lists.xmission.com >but where's the fractal declared?< Mathematically speaking, the actual fractal is an abstract concept. Different choices of rendering the same formula are technically the same fractal. Sincerely, Collin Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) Classic FOTD 04-11-00 (Fractally Exciting [8]) Date: 03 Nov 2000 19:35:25 -0500 (EST) Classic FOTD -- November 04, 2000 (Rating 8) Fractal visionaries and enthusiasts: There's a lot of fractal in today's classic fractal, so much fractal in fact that I found the image fractally exciting. I named the picture accordingly, and rated it an outstanding 8. Once again I unwrapped the MandelbrotMix4 formula to search for my CFOTD. The exact fractal formula that was iterated to produce the rather spectacular midget is 0.1Z^(-1000)+Z^2+(1/C). The escape radius is 100. As do all fractals, the image has detail beyond limit. But this fractal exceeds even the expected detail. Rarely have I seen such a variety of color and detail in a fractal, especially a one-layer image rendered with the usual flat equal-iteration bands and inside=0. Of course, I revved up the colors a small amount in a graphic program, but the processed color palette has been incorporated into the parameter file, so regardless of whether one downloads the GIF image from: alt.binaries.pictures.fractals or from: or renders it directly from the attached parameter file, the image will display the full range of colors. Since the parameter file takes almost 18 minutes to render on a 200mhz Pentium, the download is the wiser choice. The fractal weather today was once again perfect. The high temperature reached 73F (23C), which made both the cats and me happy. The philosophy is still stagnated, waiting until my muse returns. Regardless of whether the muse returns tomorrow, I shall return with another fractal and a few words to go along with the fractal. For now, the day's work is done, and it's time to settle down for a relaxing evening in front of the TV, especially with a junky old movie or two showing. Until tomorrow, take care, and don't count your fractals until they're rendered. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Fractally_Exciting { ; time=0:17:51.43 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=-177.609990921166/+0.03714106316788/2.283\ 007e+008/1/-127.499/0.004 params=0.1/-1000/1/2/0/0 float=y maxiter=2000 inside=0 logmap=329 periodicity=9 colors=000pgzwnzzuzwrurprmnngmkbif_gbVf_PdXKaR<2>7XH\ CRGGMEKJCOEBRB9VEBXGCYJE_KGaMHdPJfRKgTMiXOkYPm_RnVXp\ PapMdrHisCns9rp6nm4mi2kf1ib0g_0d<2>P0_M0YK0XJ0TH2RGB\ PGHOEPMCXKBdJBkH9fG7bE7_C6XC4TB4P92M72J74O66R66V47_4\ 7b49f2Bi2Bn1Cr1Cu1Ey0Gz0<2>Hz0Mz1Pz2Tu6Xp7_i9bdCf_Ei\ TGmOJpHK<2>z1Rz0Tz0Yy0au1fs2ir4mn6rm7ui9zgBzfCziJsmP\ fpXTrdHn`EkYBgT9fR6bP4_N1XL0VJ0RH0OG0KD0JB0G90C60D50\ EC0GE0JE0KG0MG2PH7RHCVJHXJMYKRaKXbMadMfgYdkidmsdigOg\ X9fK0aO0YR0TV2PY4Ma7Hd9EgCBkE6nH2rJ0sKya7pXCgRG_MJTH\ MKCRC7V42Y00a24d79f<2>KPmPVpTar<2>fpy_spTwgMy_GzRBzK\ EyJHsHKnGOiGRfEVaCYXBaRByM9BJ7gE6n96r44u02y02nM1dk0X\ z0dz2ky6rsBymEzgJzbMzYP<2>zX6yX0yYCyYOy__y_kyawyazya\ zpbz<3>OizHkz9mz2nz0nyYMzz0zr7zbJuOXp7gk0uf0zb0zYGuV\ YpR_uXay_<3>gzrkzknzfpzaszVwzPyzKzzGzz9zz4zz0<2>zz0T\ zzYzzdzzkzz } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "David Jones" Subject: Re: (fractint) Fractal Geometry Summer Workshop Date: 03 Nov 2000 20:02:51 -1000 On 3 Nov 00 at 14:19, Barry N. Merenoff wrote: > Message text written by > INTERNET:fractint@lists.xmission.com > >The book "Turbulent Mirror" has a very good discussion > and explanation of fractals that would be very good for > newbies to fractals. < > > I thought "Turbulent Mirror" was too philosophical. > "Fractals Everywhere" sticks more to the subject. It is, particularly later on. But the explanation of who a fractal is and how they are made is very accessible. Another blast of bits from David http://home.hawaii.rr.com/aliasjj/ http://www.hawastsoc.org/ For the best Hawaii & Pacific Basin surf forecast: http://www.surfreporthawaii.com Random Thought for this Nanosecond Welfare is a class for Liberal Arts majors. (D.Jones) Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: (fractint) Re: Date: 04 Nov 2000 01:55:46 EST >i´m a big admirer of the fractal-art and i love your page...i would like to >know: >is there a beginners manual for working with/on fractals; some explanations >, photographs, webpages... i´m also intetested in books. >i´d love to create my own fractals! I suggest downloading Fractint (http://spanky.triumf.ca/www/fractint/fractint/html IIRC) and browsing its online help. _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "David Jones" Subject: Re: (fractint) Fractal Geometry Summer Workshop Date: 03 Nov 2000 22:14:56 -1000 On 3 Nov 00 at 20:02, David Jones wrote: > It is, particularly later on. But the explanation of who > a fractal is and how they are made is very accessible. Oh, dear! Now I have to wonder if fractal sets are complex enough to develop intelligence! #-) Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: Re: Midgets - Re: (fractint) FOTD 29-10-00 (The Green Goblet Date: 04 Nov 2000 21:47:39 +1300 At 14:13 03/11/2000 -0500, you wrote: >Message text written by INTERNET:fractint@lists.xmission.com > >In "unconnected" Julias >(or "dusts"), the set is - what topologists would call - of measure zero, >which is to say that the points of the set are isolated from each other.< > >Not quite. A dust has a "topological dimension" of zero. A connected Julia >has a topological dimension of one, and a fractal with a decorated interior >has a topological dimension of two. Note that the topological dimension is >always an integer, and is not the quantity usually referred to as >dimension. That usual quantity is the Hausdorff dimension, which is always >greater than the topological dimension, and may be fractional. The measure >of a fractal is in units of length to the power of the Hausdorff dimension. If you're using a Hausdorff measure, that is - Lebesgue measure was what I had in mind. Whether it was appropriate could be debated, but what I was emphasising was that the Julia dusts themselves are never actually seen in any rendering (the connected components of which always being to small to be drawn), only their surroundings. So topological dimension was more relevant than Hausdorff. I shouldn't have said "isolated", it is true - I should have said "disconnected". >The Mandelbrot Set, with a solid-color fill, Just say "the boundary of the Mandelbrot set" :-) >has a topological dimension of 1 and a Hausdorff dimension of 2... >This means that the boundary forms structures that >appear to be filled in with a boundary-only area, but which when magnified >are always seen to be merely a curve. But still appears to fill an entire area even when magnified. Morgan "My rust is flaking" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Fernando Bresslau" Subject: Re: Midgets - Re: (fractint) FOTD 29-10-00 (The Green Goblet [5]) Date: 04 Nov 2000 11:22:50 -0200 Look at today´s FotD. If you watch the formula, you´ll see that something is done to z before it is used in the formua. that´s the initialization, and if I understood it correctly, it ensures that the midgets found in the fractal aren´t distorted.. Fernando Bresslau frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), *****z=(-a*b*g*h)^j,***** k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } ----- Original Message ----- Sent: Friday, November 03, 2000 4:38 PM Message text written by INTERNET:fractint@lists.xmission.com >I think that the iteration should be trapped with some starting values< That's an interesting idea. Could you please elaborate on it? Or maybe send a sample Par? Sincerely, Collin Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" _________________________________________________________ Do You Yahoo!? Get your free @yahoo.com address at http://mail.yahoo.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Barry N. Merenoff" <110144.2274@compuserve.com> Subject: Re: Midgets - Re: (fractint) FOTD 29-10-00 (The Green Date: 04 Nov 2000 09:37:50 -0500 Message text written by INTERNET:fractint@lists.xmission.com >that=B4s the initialization, and if I understood it correctly, it ensures that the midgets found in the fract= al aren=B4t distorted..< That's something I've never understood about MandelMix4. I thought that t= he best initialization is one which makes the derivative of the iteration zero. The initialization in MandelMix4 makes the derivative of the iteration z*k*(a*b*z^b+d*f*z^f) I don't understand the significance of this value. Sincerely, Collin Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "=?ISO-8859-1?B?UHVza+FzIElzdHbhbiBqci4=?=" Subject: Re: (from Barry N. Merenoff) Midgets - Re: (fractint) FOTD 29-10-00 (The Green Goblet [5]) Date: 04 Nov 2000 22:24:06 +0100 >>I think that the iteration should be trapped with some starting values >That's an interesting idea. Could you please elaborate on it? Or maybe send >a sample Par? I mean that with some starting values, the value of the iterated variable should stay 'trapped' below a low value. That appears in the inside part of the Mandelbrot-set, the inside of a connected Julia-set, the zero area points of an unconnected Julia-set. In these cases, |Z| never exceeds 4. That's nothing new. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jonathan Osuch" Subject: (fractint) Fractint Version 20.1 patch 2 Date: 04 Nov 2000 20:03:22 -0600 All, The executable for patch 2 to version 20.1 is now available as fradev.zip at: http://www.fractint.org/ftp/ Here's what's new: Removed the changes to the savegraphics() and restoregraphics() routines made in patch 1. The changes were causing corrupted images with some resolutions and video adapters. Updated Bret Mulvey's email address. Jonathan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) Classic FOTD 05-11-00 (The next Fractal [6]) Date: 04 Nov 2000 21:45:55 -0500 (EST) Classic FOTD -- November 05, 2000 (Rating 6) Fractal visionaries and enthusiasts: Today's fractal features the next midget in an apparently endless series of midgets, which is reason enough to name the picture "The Next Midget". Yes, I realize that a name such as "The Final Midget" or "Dancing Midget" would be more poetic, but I was not trying to be a poet. I was simply trying to name a fractal. The bluish-gray picture, with its metallic appearance and broad, intricate filaments, rates a 6, which is a little above average. I gave the image just the slightest boost in a graphic program. The graphic boost is included in the parameter file. The expression behind the image, Z^(-14)+2.5Z^(-1.45)+(1/C), is simple enough, and thanks to the wonder-formula MandelbrotMix4, it produces a fractal filled with midgets. BTW, I call the M-Mix4 a wonder-formula because I wonder why it sometimes works and other times fails to draw a fractal with midgets. The MandelbrotMix4 formula has an interesting history, which I may tell in one of these C-FOTD's. But today is not the day. It's Saturday evening and the time is near for my weekly excursion into the world of junk TV. With the parameter file having a render time of 1-1/2 minutes, it's a toss-up whether to run the parameter file or to run to Usenet at: or to the Web at: and download the GIF image from there. The fractal weather today was cloudy with a few tiny drops of rain. The temperature of 67F (19.5C) was un-notable. The cats failed to note it as they frolicked in the yard. There's no philosophy today, but it's coming, so keep in touch. You wouldn't want to miss out on the action when the philosophy breaks. Until next time, take care, and enjoy today's image. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ The_Next_Midget { ; time=0:01:29.75 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip center-mag=-1.778683555482173/-0.5422446532818447/23\ 5454.1/1/-49.999 params=1/-14/2.5/-1.45/0/0 float=y maxiter=1200 inside=0 logmap=17 periodicity=10 colors=000RQ_UTaWVdZYe`_gcajedlgfmjhplkrmmshhmeeha`d\ ZY_VTVRPPOKKKHGHCAD86C99AAC9CG8CI7DL7EO6GQ5GU3HW2I_1\ Ja1Jd<4>0PZ0QY0RY<3>0WT0YR0ZQ0ZQ5_RA_RH`RL`RRaRYaRaa\ RgcRleRrgTxjTzkTwoUqrVkuWexW_zYUzZPzZKx`HqcDje9cf5Vh\ 1Ok0Hm09o0Gj3Ke<2>HZRLcI<3>cvegzkkzqgwvepyahz_azWVzU\ OzQHzO9zK2zI0zH8zHKz<2>GuzGzzKzzOxzTuzWqz<3>lczq_zuW\ z<2>IJz<2>W1z_0zV0zQ1z<3>7Cz2Ez0Hz0Jz2HzAEzJDzRAz<2>\ o6z<3>sAzsCzuDz<3>xIzyJzzKzzKz<8>eVzcWz`Yz<2>U`zRazQ\ `z<2>PZzOYzOWzNWzNVzLUzLUz<3>rTz<3>e_za`z_azWdzUez<3\ >HkzDmzAoz7pz5qz9oz<7>aezedzhcz<3>wZzaRzHKz0Ez0Lz1Tz\ <2>8mzAuzCzzJszQkzWczcVzjNzpGzhHzcIzYJzRKzLLzGNz9Oz3\ Pz0PzEYzVdzkkzzrz<2>zNzzKz<2>zGzETzEQzGPzGNzHKzHJzIH\ zIGz<2>POz } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Barry N. Merenoff" <110144.2274@compuserve.com> Subject: Re: (from Barry N. Merenoff) Midgets - Re: (fractint) FOTD Date: 05 Nov 2000 04:02:19 -0500 Do you know a procedure for finding the maximum value of |Z| for an arbitrary formula? Sincerely, Collin Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: TEXART4U2@aol.com Subject: Re: (fractint) Beta version of new animation utility for Fractint available Date: 05 Nov 2000 10:51:20 EST Can this utility allow me to convert "color" cycled animations from the real time Fractint into an AVI file? I love color cycling and have been spending my time learning to manipulate 256 color fractals. Let me know. Tom Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Rupert Millard" Subject: Re: (fractint) Re: List of fractal programs by P.N.L. Date: 05 Nov 2000 16:26:14 GMT Paul, >For an exhaustive list of fractal generators, galleries featuring >fractals, and other fractal related information, go to the following: > > http://home.att.net/~Paul.N.Lee/Fractal_Software.html This is *very* helpful, there are lots of "exhaustive" / "definitive" lists of fractal software out there: http://www.geocities.com/arangas/index.html http://www.eclectasy.com/fractovia/fractal_generators/fractals_freeware1.html http://thinks.com/software/fractals.htm & the ones on http://spanky.triumf.ca, http://www.fractalus.com etc. but I've not yet seen one quite so "exhaustive" / "definitive" as yours! Keep up the good work, From, Rupert _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul N. Lee" Subject: Re: (fractint) Re: List of fractal programs by P.N.L. Date: 05 Nov 2000 11:56:41 -0600 Rupert Millard wrote: > > Paul, > > >For an exhaustive list of fractal generators, galleries featuring > >fractals, and other fractal related information, go to the following: > > > > http://home.att.net/~Paul.N.Lee/Fractal_Software.html > > This is *very* helpful, Thank you so *much*!! But the above link is not the "exhaustive" list of software, nor does it claim to be. The preceding sentence mentions other areas of fractal concern like galleries, etc., and is also followed by the following two additional links: http://home.att.net/~Paul.N.Lee/Fractal_Links.txt http://home.att.net/~Paul.N.Lee/Fractal_Census.html The three combined URL, will make up the "exhaustive" list of most things related to fractals. > > there are lots of "exhaustive" / "definitive" > lists of fractal software out there: > http://www.eclectasy.com/fractovia/fractal_generators/fractals_freeware1.html > > http://thinks.com/software/fractals.htm > Where do you think the above two originally got their information from?? I gave Juan Luis permission back around July 05, 1999 to use that information for his website. > > Keep up the good work, Thank you again, and I hope to be able to continue doing so. Sincerely, P.N.L. http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul N. Lee" Subject: (fractint) Fractals in Multimedia Date: 05 Nov 2000 13:14:23 -0600 The Institute for Mathematics and Its Applications (located at the University of Minnesota, Twin Cities Campus, in Vincent Hall) will be having a "Minisymposium" concerning _Fractals in Multimedia_, scheduled for January 17-19, 2001. Some of the people involved are as follows: Michael Barnsley Steven Demko Ken Musgrave Heinz-Otto Peitgen and about 20 more... Further information may be found at the following: http://www.ima.umn.edu/multimedia/winter/ms.html Sincerely, P.N.L. http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) Classic FOTD 06-11-00 (Abstraction 01 [7]) Date: 06 Nov 2000 00:12:53 -0500 (EST) Classic FOTD -- November 06, 2000 (Rating 7) Fractal visionaries and enthusiasts: I appear to be on a roll. One above-average fractal after another keeps turning up. In keeping with the trend, today's image, which for lack of a better idea has been named "Abstraction 01", rates an above-average 7. The formula of today's scene is Z^1.03-Z^(-1.5)+(1/C). The calculation was once again done by the mysterious MandelbrotMix4 formula, which appears strange but produces midgets by the thousands. The parameter file finishes in 12-1/2 minutes on a reasonably fast Pentium. The image file downloads much faster from: alt.binaries.pictures.fractals or from: The fractal weather today was sunny but with puffy white clouds, and a temperature of 57F (14C), which was barely warm enough for the fractal cats. I wish my philosophizing were doing as well as my fractal searching. Once again I failed to find the inspiration to write. But I'll try again tomorrow. Until then, take care, and what did we do with our idle time before fractals existed? Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Abstraction_01 { ; time=0:12:35.44 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+0.24270803302426930/+4.39028735472479500\ /265776.6/1/22.5 params=-1/-1.5/1/1.03/0/0 float=y maxiter=1800 inside=0 logmap=213 periodicity=10 colors=000S4zT1z<2>Y0zb0zh0zX0z`0zS0zQ0wN0tM0qJ0nH0k\ E0hD0eA0b80_50X40T10Q<2>00H00K11N<7>PQhSTkVXnY_q`ctc\ fufixilz<2>ruzqozokzoezn`znVzlQzkKzkGziAzi5zkEzlNznX\ zoexqnwut0qq0ln1hk2ch4_e4<2>MY8HVADSA<2>0JE0EB0HE<2>\ 0PJ0SK0TM0XN0_P0`Q<3>0kX0nY0o_<3>0ze<3>0zk0ze0x_2tT7\ oP<3>PY2T_4X`5`b7cb7fc8keAneAqfBuhDxiEziEzkGzlHzlHzo\ EtqBkrAbu7Tw4Kx2Bz02z00z00z00z0<3>1o01l02h0<3>8X0AT0\ 0b0EQ0MG0T40`00<2>w00z20z50<2>zE2wH5oK7iNAkQBkTElXGl\ _JnbKneNohPokQkfT<4>XPhTMkQHn<3>E4z70zB1zG5xJAuNErSJ\ oVNk_ShcXef`bke_oiVrnSwrPzwMzzJwwK<2>`iKeXJiKKn8HoBK\ oEMoGPoJQoKSoNVoQXoS_oV`oXbo_eobfociofkohlkikfkkclk_\ nkXoiSqiNriKtiGuhDwh8xh5zh8zfAzeDzcEzbHz`Jz_MzYNzYPz\ XSzVTzTXzSYzQ`zPbzNczNfzMhzKkzJlzHozGqzEwzGrzEnzDPzz\ Qzz } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Thore Berntsen Subject: Re: (fractint) Beta version of new animation utility for Fractint available Date: 06 Nov 2000 09:09:16 +0100 (CET) --19315031.973498156241.JavaMail.webmail1@wm-java3.fg.online.no Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit > > Can this utility allow me to convert "color" cycled animations from the real > time Fractint into an AVI file? I love color cycling and have been spending > my time learning to manipulate 256 color fractals. > > Let me know. Tom > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > > > Yes it animates colors. --19315031.973498156241.JavaMail.webmail1@wm-java3.fg.online.no-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: (fractint) Obscure case where diffusion gives poor estimates. Date: 06 Nov 2000 04:13:59 EST deep_1_54 { ; Version 2001 Patchlevel 1 reset=2001 type=mandel passes=d center-mag=-0.74526321750669670/+0.11304138430272110/1.263809e+009/0.999\ 7 params=0/0 float=y maxiter=1048576 inside=0 outside=0 logmap=1122 distest=-1/71/1024/768 colors=zzz000<56>EEEEEEEEE<2>FFFFFFIII<7>fffjjjmmm<3>zzz<10>aaaZZZXXX<2>\ QQQNNNNNN<157>zzz video=AF7 savename=frmig_54 } Diffusion on this one initially estimates 8 hours on a PII-400, but this climbs to about 12 by the time it finishes. _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: Re: (from Barry N. Merenoff) Midgets - Re: (fractint) FOTD Date: 06 Nov 2000 19:42:46 +1300 At 04:02 05/11/2000 -0500, Collin wrote: >Do you know a procedure for finding the maximum value of |Z| for an >arbitrary formula? I strongly suspect that there no such procedure exists - that no matter what procedure one may come up with, there will be formulae for which it fails to give a (correct!) finite upper bound for |Z|. Morgan L. Owens "I have discovered a truly marvellous demonstration of this conjecture which this .sig is too short to contain." Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 07-11-00 (Pi Fantasy [6]) Date: 06 Nov 2000 21:11:59 -0500 (EST) Classic FOTD -- November 07, 2000 (Rating 6) Fractal visionaries and enthusiasts: Today's fractal is a slice of pie, or perhaps I should say pi. The expression that was iterated to draw the image is Z^(pi)+C. To add a bit of interest, I calculated the expression with the MandelbrotBC formula, which draws the remote parts of the infinite spiral of fractals with fractional exponents of Z. To keep with the 3.14159 theme, I also set the second parameter to pi. The parent fractal looks a lot like the Z^3+C Mandeloid fractal, though it is crooked, and its west valley is split. To see this parent fractal, reset the logmap to 1 and back out of today's image, which is located in the area where the west valley broadens and splits. Perhaps the most unusual feature of the image is the tattered appearance of the features surrounding the midget, and the near total lack of symmetry. The midget itself, which closely resembles the cubic Mandeloid, is surrounded by many other midgets, none of them explored. The attached parameter file takes 9-1/2 minutes to render on a 200mhz Pentium machine. The download of the image from usenet is far faster, that is if the image file makes it to your news server. The newsgroup in question is: The image also will soon be posted to Paul Lee's web site at: The fractal weather today was perfect, with blue skies un-marred by the slightest trace of cloudiness, and a temperature of 56F (13C), which so thrilled the fractal cats that they spent most of the afternoon sleeping in the sun in their chairs on the porch. The philosophy went nowhere today, but it's time to shut down Fractal Central and go somewhere myself. Until next time, take care, and be kind to your fractals. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Pi_Fantasy { ; time=0:09:34.68 -- SF5 on a P200 reset=2001 type=formula formulafile=branchct.frm formulaname=MandelbrotBC passes=1 center-mag=-0.3953\ 8899237559290/-0.08378373837276828/2244856 params=3.14159265358979/0/3.14159265358979/0 float=y maxiter=3000 inside=0 logmap=169 periodicity=10 colors=000IAIIAI<3>IGIJHIKII<3>PIIQIIRIITIIRII<3>QII\ PIIPIIQIIQIIPHINCIK7CI03H07<3>H9HHCJGEN<3>GOWGQZETa<\ 3>EakEcmGalGakG`jG`h<3>GZeGYdGYdGWcGWa<3>GUZHTYHTWHR\ W<2>HQTHPTHPR<2>HNOHNOHLNHLLHKKGJJ<8>JLKKLKKLKKNKLNK\ LNKLNKNNK<8>QPKQPKQPK<2>RQKRQKTQK<5>VRKVRKVRKWRKWTKW\ TKYTK<7>_UK`UK`VK<2>aVKaVK`WGaVIaVKcVLcUO<2>dTTeTVeT\ YfRZfR`gRagQdgQehQghPjjPkjPmkOokOqjPr<2>lNvlNwmLxmLy\ yKzoKz<5>rHzrHzrHzsGzsGzuEz<2>vDzvDzuGzuHzsJzsKzrLzr\ OzqPzqQzpTzpUzoWzoYymZv<3>kegkfdjhejjghkjhmlgoogpphq\ mhqljrkjrjjshksgkuf<3>mvamw`mw_oxZ<3>pzUqzTqzR<3>szN\ szLszKuzJuzIwzIuzHszHqzHpzHozHlzHkzHhzH<3>czGazG_zGZ\ zGazf<4>_zd } frm:MandelbrotBC = { ; Z = Z^E + C e=p1 p=real(p2)+PI q=2*PI*trunc(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z|<100 } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: (fractint) FOTD Date: 07 Nov 2000 13:29:25 GMT Hi Jim. I just wanted to say that "Abstraction 01" and "Excited Fractal" are both really excellent! Keep it up! Andrew Coppin "All elliptic equations are really modular forms." _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 08-11-00 (Three Trees [5]) Date: 07 Nov 2000 21:56:52 -0500 (EST) Classic FOTD -- November 08, 2000 (Rating 5) Fractal visionaries and enthusiasts: Today's fractal has no quadratic midgets. I've been producing almost nothing but such midgets lately, and it might be time for a midget break. Oh, there are several midgets in today's picture -- one prominent one in the lower left quadrant, and others scattered throughout the scene, but they are not the usual quadratic midgets. Instead of midgets, today's image features trees -- three trees in fact, which is the name I gave to the picture. I rated the picture a 5, mostly because I was distracted by watching the election returns, and gave too little effort to nursing my fractal. Yesterday's image featured the number known as the Greek letter pi. Today's fractal features the number known as the golden ratio, which has a value of 1.618033989..., and which by a strange coincidence happens to be the square root of 5, plus 1, divided by 2. To make the fractal doubly golden, I also entered -1.618033989 into the MandelbrotBC formula as the second parameter. The parent fractal is a curious thing, an obvious Mandeloid standing on its head, with much chaos and many filaments around its main bay and rudimentary buds. The trees of today's image are located on the WSW shore of the bay, just below the second discontinuity. This parent fractal is filled with interesting nooks and crannies, all of which deserve a more thorough examination. Perhaps I'll return to it for tomorrow's C-FOTD. A benefit of an image with a magnitude as low as today's is that it is fast. The parameter file renders in only 26 seconds on a Pentium-200. On one of those 800mhz machines, it will finish in 10 seconds or so. But if running the parameter file is too much of a hassle, the GIF image file has been posted to the Usenet binary newsgroup: and before long it will also be available on Paul Lee's web site at the URL: The fractal weather today was surprisingly mild. The temperature of 64F (18C) and partly sunny skies lured the cats outdoors, where they spent the afternoon lounging on the porch, watching the insects hovering around the still-blooming marigolds. For all those waiting with bated breath for my next round of fractal philosophy, there is nothing but disappointment. I'm sorry, but too much work combined with too much distraction left nothing to act as inspiration. So the philosophy will once again be delayed, but eventually it will appear -- it always has in the past. For now however, I'm settling down to watch the election returns to see how my guy makes out. Until tomorrow, when depending on the outcome, I'll be either pleased or disgruntled, take care, and may your wisest wishes come true. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Three_Trees { ; time=0:00:26.42 -- SF5 on a P200 reset=2001 type=formula formulafile=branchct.frm formulaname=MandelbrotBC passes=t center-mag=0.163588/-1.36873/6.622925/1/-142.5 params=1.618034/0/-1.618034/0 float=y maxiter=6000 inside=0 logmap=4 periodicity=10 colors=000F9gFIgFAjF3mO0pX7mcIllSisagzjfxVVuFLr0A70A\ A79CD9FJ7GP77OMDGo0M`IFsVJLILV4LdQp0Ml7IgDDcL9`Q4XX0\ Sc0OiXQzJOx6MszzOrySisV`m_SgaJadAXi1QlIOr9Mp0Lo0vfD0\ T7zz4zy3zx1sv<3>0QpzxmjmoTcoAToGLy4LssJzjLzcLzVLzOLz\ GLx7Lu0LrzXurVsiTs`SrSQrJPpAOp1MozzzLg_FcaA_d6Xg1Sj0\ Omz0rz0pp0pd1pS6oGCo4GoXGgJIj6Jm9zJ0d_joYJ_f__zLTz6P\ u0G00JL_TYSS`MQcGPfAOg4Mj0LmMjzFcy7Yv0Qrm0zL7v04009A\ <2>0Id03z06z07z0Ay0Cx0Fu0Gs0JpyCLaFVFIdz7`yAclCfYFgL\ Gj6JmMI0CJA1LVvvzPcul0zL3zQzxMzvIxuDrs9js4cr0Yp0Qo9m\ 06i03d91`I0XQ0S_0Og4Fx1Gv0Iu0Is0Jr0LpVvzIiz4Xx0Px0Ou\ 0Ms0Mr0LpOi4JdAFaGC_M7XS3TY0Qc0Oi60v04r0zm0zP0uX0ia0\ XiVzVu7iiAj_ClPFlDGm3Jog0XQ4c9DiPmdLifGfgCai9_j4Vl0S\ m0OoL_LFXQATV6S`1Pd0Mj00V06a0DiazVXzYQx`LrcFjd9cg3Yj\ 0Qm0zo0so0go0XofL0XL7MLJCLT1LdIm0Cg07aD1XQ0QcT9iiFzS\ IzAJupP0cf0Ta0LYCATP1PalfF`aMPYTrJzuJz } frm:MandelbrotBC = { ; Z = Z^E + C e=p1 p=real(p2)+PI q=2*PI*trunc(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z|<100 } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "=?iso-8859-1?B?UHVza+FzIElzdHbhbiBqci4=?=" Subject: (fractint) Re: Obscure case where diffusion gives poor estimates. Date: 08 Nov 2000 18:16:11 +0100 >Diffusion on this one initially estimates 8 hours on a PII-400, but this >climbs to about 12 by the time it finishes. What is the mode assigned to AF7 in your CFG file? I had some ideas. (So far I remember, the original CFG file had no mode assigned to ALT+F7, but anyway, I don't have it :( ) Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "=?iso-8859-1?B?UHVza+FzIElzdHbhbiBqci4=?=" Subject: Value of |Z| (Re: (from Barry N. Merenoff) Midgets - Re: (fractint) FOTD 29-10-00 (The Green Goblet [5])) Date: 08 Nov 2000 18:16:16 +0100 Try the 'inside=zmag' mode. It won't show the exact value, but you'll see the changes depending on the starting values if the area in question is 'inside'. If it isn't, try making it 'inside' by setting the max. iteration count to a low value, or modify the formula so that it has no bailout (so no 'outside' parts.) Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 09-11-00 (Sunflower [4]) Date: 09 Nov 2000 00:01:01 -0500 (EST) Classic FOTD -- November 09, 2000 (Rating 4) Fractal visionaries and enthusiasts: Today was an exceptionally busy one here at Fractal Central, leaving almost no time for fun with fractals. But I did find another midget. This midget is surrounded by what appears to be the petals of a sunflower, so that's the name I gave it. The expression -10Z^(-1.3)-Z^(-13)+(1/C) was calculated by the MandelbrotMix4 formula to create the image, which is not at all exceptional, rating a somewhat below average 4 on my scale of fractal worthiness. The parameter file's 9-1/2 minute render time is slow enough to make a download of the image file from: alt.binaries.pictures.fractals or in a few hours from: the more efficient way to go. The fractal weather started deteriorating today, with lots of clouds and a temperature of 64F (18C). Recognizing less-than- perfect conditions, the fractal cats spent only a limited time outdoors. As for philosophy, there is none, but I'll return in 24 hours with a hopefully higher-rated fractal and more to tell about it. Until then, take care, and may the better man win. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Sunflower { ; time=0:09:37.21 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+2.72767006651009100/+0.39885761742574140\ /1.266804e+008/1/-105 params=10/-1.3/1/-13/-2/100 float=y maxiter=2400 inside=0 logmap=144 periodicity=9 colors=000bQR<9>hbihckidm<3>kit<13>RnnQnnOnm<3>Jol<3\ >FgaEeZDcXCaUB_R<3>7PH6ME5JB5I97L88M8AP8BQ8CT8EU7FX7\ HY7I`7<5>Qh6Sj5Tk5<2>Xp5Zq4_t4`v4by4cz4dz4ez6ey8<3>f\ nEfkFfjH<13>iMaiKcjJd<3>jCj<3>XQmTUnQXoN_o<25>OHDOGC\ OFA<3>OD5<2>D2t<17>RJxSKxSLy<3>VOy<6>IcWGeSEgN<3>7o7\ <3>VVV`P`fKf<2>x5w<3>3x_<23>BpPBpPBpO<2>CoNCoNFpO<3>\ NrOPsORtOTtOVuO<8>ivIkvHmvG<3>svE<2>tnJ } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 10-11-00 (Distracted Fractal [3]) Date: 09 Nov 2000 20:29:36 -0500 (EST) Classic FOTD -- November 10, 2000 (Rating 3) Fractal visionaries and enthusiasts: Today's fractal rates only a lowly 3. It earned this lowly rating because I was preoccupied while searching for the FOTD by the election chaos here in the U.S. and couldn't concentrate on the business of finding fractals. In the eyes of the world, this election situation must make the U.S. look like an illiterate nation that can't even tally up its own votes. (Which may be true.) Since the confusion distracted me from more productive things, I named the picture "Distracted Fractal" to explain its paucity. I'm not going to discuss the fractal, which speaks for itself. The best way to hear or rather see it speak is to download the GIF image file from the Usenet binary group: or from the web site: The fractal weather today was cloudy with spitting rain that never amounted to anything. The temperature of 63F (17C), was quite mild for mid-autumn. The fractal cats, after observing the morning from the cover of the porch, decided that the outdoors was too wet, and passed the afternoon sleeping. Now it's time to shut down the fractal shoppe and call it an evening. Instead of overloading myself with election hype, I'm going to settle down and watch a great old "creature feature" style movie or two. Until next time, take care, and see you in 24 hours. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Distracted_Fractal { ; time=0:10:34.06 -- SF5 on a P200 reset=2000 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+1.907196013519638/-0.7756187527715576/1.\ 567757e+007/1/-102.499 params=10/-1.3/1/-13/-2/100 float=y maxiter=1400 inside=0 logmap=200 periodicity=9 colors=0000Qd0Rb0Rb0Rb0Ta0Ta0Ta0Rb0Qb0Ob2Nb6NbBLdEJd\ IIdLGdOGdTEfXDf_Bfb9ff9fd8bb8ab8Ya6X_6V_6RY4QY4OX4LV\ 2JV2GT2ER1DR19Q18G0BL08Q16V84_D1dJ0iQ0qR0lV0gX2b_9Ya\ GVdN<2>GkfBnl8pq0z4Dz8iz9zz9zzBzxBzsBznDziDzdDzYBz_D\ z_Dz_Ez_EzaGzaGzaGzaI<2>zbJzbJzbLzdLzdNzdNzdNzfOzfOz\ fQzfQzfQzdNzbLzaJz_IzYEzXD<3>zQ4zO2zN1<3>zG0zB0zE0zG\ 1xIB<3>VOn<3>nDas0az0Q<4>z0Qz1Q<3>zEQzIQzLQxOQwRQwVQ\ tYQsaQsdQqgQtlOqkQpkQ<2>ikQgkQfiR<2>_iRYiRXiRVgTTgTQ\ gT<2>LgTJgTIiVIkVIkXGlXGnYGnYGpYEp_Eq_EsaDsaDtaDwbDw\ bBxdBxdBzd9zf<2>9zg8zg8zi8zi6zk6zk6zk6zl4zl4zn4zn4zl\ 4zn4zn4zp4zp4zq4zq4zs4zs4zs4xt4wt4tw4qw4px4nx4lx4kz<\ 2>4dz4bz4az4_z4Yz4Xz4Tz<3>4Nz4Lz0Iz<4>BJzDJzGJzIJzJJ\ zNJzOJz<3>XJz_JzaJzbJzJEzdJzzLzxNzxNzxOzxOzxQzxQzxRz\ xRzxTzxTz0Oz0Qz0Qz } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: htes htes Subject: (fractint) How to run Fractint in the Background? Date: 09 Nov 2000 20:10:43 -0800 (PST) Hi, I was wondering if it is possible to run the DOS version 20.0 of Fractint in a box in windows 95, so that I can do other things while fractals are generating. My question pertains specifically to running a batch file to generate a sequence of images. i.e. start.bat ------- fractint @parfile1 fractint @parfile2 fractint @parfile3 fractint @parfile4 How can I minimize or restore the Fractint window such that other things in Windows 95 can be done while Fractint is running? If I have a 800 frame animation, I don't want my computer tied up for that enitre time, I should be able to do other things on my computer while it is running. Any tips? thanks _______________________________________________________ Say Bye to Slow Internet! http://www.home.com/xinbox/signup.html Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "David Jones" Subject: Re: (fractint) How to run Fractint in the Background? Date: 09 Nov 2000 18:30:31 -1000 Sure you can (I've done it), but don't expect to get much else done with W95. And be very careful about your display drivers - W95 doesn't always play nice with DOS graphics programs. On 9 Nov 00 at 20:10, htes htes wrote: > Hi, I was wondering if it is possible to run the DOS > version 20.0 of Fractint in a box in windows 95, so that > I can do other things while fractals are generating. > > My question pertains specifically to running a batch > file to generate a sequence of images. i.e. > > start.bat ------- > > fractint @parfile1 > fractint @parfile2 > fractint @parfile3 > fractint @parfile4 > > How can I minimize or restore the Fractint window such > that other things in Windows 95 can be done while > Fractint is running? > > If I have a 800 frame animation, I don't want my > computer tied up for that enitre time, I should be able > to do other things on my computer while it is running. > > Any tips? Run it under OS/2. Works just fine here! Another blast of bits from David http://home.hawaii.rr.com/aliasjj/ http://www.hawastsoc.org/ For the best Hawaii & Pacific Basin surf forecast: http://www.surfreporthawaii.com Random Thought for this Nanosecond Unused genius is identical to foolishness. (D.Jones) Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Scott Boyd Subject: Re: (fractint) How to run Fractint in the Background? Date: 10 Nov 2000 00:21:22 -0600 On Thursday 09 November 2000 22:30, you wrote: > > How can I minimize or restore the Fractint window such > > that other things in Windows 95 can be done while > > Fractint is running? > > > > If I have a 800 frame animation, I don't want my > > computer tied up for that enitre time, I should be able > > to do other things on my computer while it is running. > > > > Any tips? > > Run it under OS/2. Works just fine here! > Or run Xfractint with a true multi-tasking OS like Linux. Xfractint behaves well with Linux also! Scott Boyd -- sdboyd56@swbell.net http://home.swbell.net/sdboyd56/ A computer without a Microsoft operating system is like a dog without bricks tied to it's head. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "David Jones" Subject: Re: (fractint) How to run Fractint in the Background? Date: 09 Nov 2000 21:35:51 -1000 On 10 Nov 00 at 0:21, Scott Boyd wrote: > On Thursday 09 November 2000 22:30, you wrote: > > > > How can I minimize or restore the Fractint window such > > > that other things in Windows 95 can be done while > > > Fractint is running? > > > > > > If I have a 800 frame animation, I don't want my > > > computer tied up for that enitre time, I should be able > > > to do other things on my computer while it is running. > > > > > > Any tips? > > > > Run it under OS/2. Works just fine here! > > > Or run Xfractint with a true multi-tasking OS like > Linux. Xfractint behaves well with Linux also! My other box is running Linux right now (in fact, I'm looking at consolidating my two boxes into one triple-booting thing - W9x, OS/2, Linux) so I can put in a home file and print server). I've never installed any X-apps on the system except those that came with it. Any pointers? Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: BeyerTh@t-online.de (Thomas Beyer) Subject: Re: (fractint) How to run Fractint in the Background? Date: 10 Nov 2000 12:48:34 +0100 htes htes schrieb: > > Hi, I was wondering if it is possible to run the DOS version 20.0 of > Fractint in a box in windows 95, so that I can do other things while > fractals are generating. > In Windows there are always problems with fractint's graphic-routines. Using Disk-Video, however, I never had a problem running fractint in the background in a DOS-box. Win95 is at least as stable, that it won't be clogged by a DOS-applicatian (as it might have been with Win 3.x). Of course you must accept, that you are using CPU-power, so playing computer-games or downloding huge files in the foreground is not recomended. Most other things (even internet-access) are generally possible. (I'm running fractint, while sending this message BTW, I hope it won't become a mess :-) Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: Obscure case where diffusion gives poor estimates. Date: 10 Nov 2000 14:24:04 EST >What is the mode assigned to AF7 in your CFG file? Disk video, 1024x768x256. _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) How to run Fractint in the Background? Date: 10 Nov 2000 14:32:26 EST >Hi, I was wondering if it is possible to run the DOS version 20.0 of >Fractint in a box in windows 95, so that I can do other things while >fractals are generating. > >My question pertains specifically to running a batch file to generate a >sequence of images. i.e. > >start.bat ------- > >fractint @parfile1 >fractint @parfile2 >fractint @parfile3 >fractint @parfile4 > >How can I minimize or restore the Fractint window such that other things in >Windows 95 can be done while Fractint is running? > >If I have a 800 frame animation, I don't want my computer tied up for that >enitre time, I should be able to do other things on my computer while it is >running. > >Any tips? >thanks Sure. Run it in disk-video mode, in a DOS box (return from mullscreen when disk-video is set), and push in the "run in background" button on the toolbar of the DOS box. As for the batch file, design it like the makemig.bat output for D&C images: Fractint batch=yes overwrite=yes @dem.par/deep_1_63 Fractint batch=yes overwrite=yes @dem.par/deep_1_64 ... The par entries should set a disk video mode (a good reason to assign 1024x768x256 disk-video to a key in fractint.cfg -- I use AF7) and a savename. For better crash recovery, use savetime=60 or so in sstools.ini. _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) How to run Fractint in the Background? Date: 10 Nov 2000 14:37:03 EST >Of course you must accept, that you are using CPU-power, so playing >computer-games or downloding huge files in the foreground is not >recomended. Most other things (even internet-access) are generally >possible. Downloading works fine actually. So does Winquake, if you set the priority above normal. Downloading is not CPU-intensive -- it is network-intensive. Fractint, OTOH, is CPU-intensive but not network-intensive. Running a fractal while downloading a batch of mp3z from Napster is a common state for my machine these days -- the two tasks make the most of available CPU time and bandwidth, simultaneously. (I also run a bottom-feeder for GIMPS...) _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "David Jones" Subject: Re: (fractint) How to run Fractint in the Background? Date: 10 Nov 2000 10:34:43 -1000 On 10 Nov 00 at 12:48, Thomas Beyer wrote: > Using Disk-Video, however, I never had a problem running > fractint in the background in a DOS-box. Win95 is at > least as stable, that it won't be clogged by a > DOS-applicatian (as it might have been with Win 3.x). > > Of course you must accept, that you are using CPU-power, > so playing computer-games or downloding huge files in > the foreground is not recomended. Most other things > (even internet-access) are generally possible. Well, when I used to try it (running in disk video mode) on this system, everything else in W95 - mouse movements, appearance of drop-down menus, etc - became jerky and slow. Wasn't doing any games or downloads, although I was most often trying to work on a book. In fact, couldn't do any kind of Internet activity (we were using a dialup connection at the time, and W95 just doesn't seem to do well with real-time communications running). On the same box under OS/2, I didn't have any such problems. I still don't have any such problems. Also W95 and Fractint would regularly fight over the display adaptor, freezing the system. I've never encountered that under OS/2. Anyway, I'm going to check out XFractint, my Linus box has a faster processor in it, anyway! 8-) Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: htes htes Subject: Re: (fractint) How to run Fractint in the Background? Date: 10 Nov 2000 15:35:44 -0800 (PST) hey thanks. But I still have problems when I run the batch file everytime the batch file runs fractint with a new paramenter specified, it changes to full-screen, and then goes back to a window in disk video mode. How do I set it up so that, when you type in fractint @blah.par/blah it stays in a window all the time? Right now, factint goes to full screen then immediatly switchs back to a window. I need it to be running in a window all the time. More specifially, I need to be able to run fractint in a window, exit from fractint, then start up fractint again while still keeping it in a window the whole time. Just setting it to disk video mode doesn't prevent it from switching from full screen to a window everytime fractint is started. Thanks. _______________________________________________________ Tired of slow Internet? Get @Home Broadband Internet http://www.home.com/xinbox/signup.html Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) How to run Fractint in the Background? Date: 10 Nov 2000 18:59:01 EST >hey thanks. But I still have problems when I run the batch file > >everytime the batch file runs fractint with a new paramenter specified, it >changes to full-screen, and then goes back to a window in disk video mode. I've noticed this too. Don't know why it does this -- IMO it's a bug, Fractint must be changing text modes or something unnecessarily. There is a workaround -- if the dos box doesn't have the focus, it doesn't happen! _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: htes htes Subject: Re: (fractint) How to run Fractint in the Background? Date: 10 Nov 2000 17:26:44 -0800 (PST) > >hey thanks. But I still have problems when I run the batch file > > > >everytime the batch file runs fractint with a new paramenter specified, it > >changes to full-screen, and then goes back to a window in disk video mode. > > I've noticed this too. Don't know why it does this -- IMO it's a bug, > Fractint must be changing text modes or something unnecessarily. There is a > workaround -- if the dos box doesn't have the focus, it doesn't happen! > > Awesome man, thanks. Now, its off to work on my 800-frame zoom to (-2,0) at magnification level 1.502*10^256!! :) _______________________________________________________ Tired of slow Internet? Get @Home Broadband Internet http://www.home.com/xinbox/signup.html Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 11-11-00 (Fractal Stickers [4]) Date: 10 Nov 2000 23:58:46 -0500 (EST) Classic FOTD -- November 11, 2000 (Rating 4) Fractal visionaries and enthusiasts: What does the whimsical expression 1.3Z^(-10.6)+6.7Z^(-1.7)+(1/C) do when iterated? Why it creates a fractal, a fractal with midgets. And today's picture illustrates one of these midgets. I named the picture "Fractal Stickers" because the sharp filaments surrounding the midget remind me of the burrs that sometimes get stuck on the fractal cats when they wander too far afield. After careful consideration, I rated the image a 4, which is a reversal of the steady decline of the past several days, but still below average. The parameter file takes about 3 minutes to set up and 4-3/4 minutes to run. The GIF image file takes about 2 minutes to access and 1/2 minute to download. The image file may be found at: and at: The fractal weather today was partly cloudy and blustery, with a temperature of 63F (17C). The temperature was mild enough for the fractal cats, but the wind was a bit too high for them to be comfortable outdoors, the thrashing branches keeping them constantly on alert. I'm exhausted after another day of high anxiety, so I'm going to settle down to watch another junky movie. I'll return in 24 hours or so, with another fractal. Until then, take care. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Fractal_Stickers { ; time=0:04:44.46 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+0.2247777530333031/+0.4283983728794734/3\ .302373e+009/1/139.999 params=1.3/-10.6/6.7/-1.7/0/0 float=y maxiter=1200 inside=0 logmap=80 periodicity=9 colors=00022V22V<3>22P22O22N22L22K22J<2>226222220<2>\ 22723C35F05H19F3CD6HA9H9CK6FL5HP2<2>PY0PZ0R`0Xb0`e0d\ h0ik0ml0ro0zr0zt0zv0<3>zw0zw0zw1zw3zs5fl7db9bXA`bDYb\ FViHSiJPwL<2>HwRFwUCwVCvVAwXAwXAyYAyYAzZAzZAz`<3>9zb\ 9zb9zd<3>9zeCzfDzhGyhHviKsiLpkOmkPklRilUfmVdoYaoZZpa\ XpbUreRrfOshNsfOrePrdRrdSrbUraVr`Xr`XrZYrYZrY`rXarVb\ rUdrUdrSerRfrPhr<2>NlrJmtLlsNlrOlpRloSlmUllXlkYliZlh\ alf<3>hkaik`lkZmkYokXrkVskUviVtkUtkStkRtlRtlPtlOtmNt\ mNsmLsmKsoJsoJsoHspGspFspFrpDrrCrrArrA<2>rs6yz0tv3rt\ 6mt9ktCftGdtJ`tL<3>OtYKt`Htb<2>6tl3to1trCtsLts<3>yts\ wrtvivtbwt`y<2>ptzozzozzfziZzOSz2SzCSzKSzUSzaSzkSzsS\ zzSzzVzzYzoZzdazUbzJez7fz0lz9pzLtzX<4>szfszhszkszlsz\ oszpszssztfzk<2>7zN2zX0ze0zo0zy<2>0zz0zz2zz<2>Azz<4>\ azz0z0 } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: Re: (fractint) How to run Fractint in the Background? Date: 11 Nov 2000 17:58:26 +1300 At 18:59 10/11/2000 -0500, Multiple Bogeys replied to htes htes by saying: >>hey thanks. But I still have problems when I run the batch file >> >>everytime the batch file runs fractint with a new paramenter specified, it >>changes to full-screen, and then goes back to a window in disk video mode. > >I've noticed this too. Don't know why it does this -- IMO it's a bug, >Fractint must be changing text modes or something unnecessarily. There is >a workaround -- if the dos box doesn't have the focus, it doesn't happen! What you want to fix are the DOS box settings that Windows uses when running Fractint. Right-click Fractint.exe's icon and choose properties. The "Screen" tag describes how Windows displays the DOS box (since these days DOS runs in Windows instead of the other way around). You currently have it being displayed in a window instead of full-screen. Change that and it won't do that jumping back and forth to a window any more. That's the workaround, the permanent solution (work in progress) is to rewrite Fractint's video code to avoid all the low-level speedups that assume that Fractint is the only program using the video card. Once upon a time (like six years ago), this would have been the case, but not now (since, when run in a DOS box, Fractint doesn't really have access to the video card, only a Windows-supplied emulation of one). If you're running in batch mode, and you want to keep Windows running in the meantime, you could instead try minimising the DOS box window. If you're not doing anything else at the time, you might want to consider shutting down Windows, give DOS the processor, and then Fractint's assumptions about where it's running would be correct. Further detail available from the Fractint home page at http://spanky.triumf.ca/www/fractint/fracwin95.html Morgan L. Owens "You want the image in a window? Why waste all that real estate on chrome?" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "=?windows-1250?B?UHVza+FzIElzdHbhbiBqci4=?=" Subject: Re: (fractint) Re: Obscure case where diffusion gives poor estimates. Date: 11 Nov 2000 18:25:15 +0100 >>What is the mode assigned to AF7 in your CFG file? > >Disk video, 1024x768x256. I have an idea what's going on. I saw that in video modes where drawing the large boxes that diffusion uses is _lot_ slower than drawing single pixels - probably the box drawing can't be optimized - that diffusion gives extremely long times in the estimation, like 10 minutes at first then it finishes in 4 seconds. First, it could be that drawing the boxes in that disk-video mode is easier than drawing single pixels or at least the overhead of the box drawing is less than expected (maybe it needs less math with pointers or less buffer switches? I don't know how that works.) Another possibility is that the areas of the image where diffusion hits first are faster than others encountered later. Try setting the fill color to 0, in that case diffusion won't draw filled boxes, only single pixels. That fixed the cases where starting the image was very slow because of the large boxes and the estimations were _very_ 'pessimistic', it may change it now too. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 12-11-00 (Wings of Iteration [5]) Date: 11 Nov 2000 19:38:06 -0500 (EST) Classic FOTD -- November 12, 2000 (Rating 5) Fractal visionaries and enthusiasts: Rating a 5, today's fractal is one step above yesterday's. Now if I can continue this gradual improvement for 5 more days, we'll have an honest 10 rated image for the 17th. I named the picture "Wings of Iteration". It has a certain airborne feeling about it that inspired the name. With a running time of 8-1/2 minutes, the parameter file is a bit slow, making a download of the GIF image the wiser choice. As always, the GIF image file may be found at: alt.binaries.pictures.fractals and at: The fractal weather today was partly sunny, though quite breezy. The 60F (15.5C) temperature was mild enough -- too bad the high wind kept the fractal cats so skittish that they remained indoors. As is obvious by the shortness of the recent discussions, I've not been inspired to write philosophy for quite some time. The reason is that I'm disgusted by the political chaos here in the U.S. (Politics is the one thing that can really make me lose my cool.) But come tomorrow, I'll have at least another fractal, even if the words are few. Until then, take care, and sometimes the greatest wisdom comes in the fewest words. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Wings_of_Iteration { ; time=0:08:26.36 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=-0.56120497942872340/+1.28019792586280400\ /12622.28/1/-90 params=10/-1.3/1/-13/-2/100 float=y maxiter=2000 inside=0 logmap=110 periodicity=10 colors=000MTALXAJ_A9aO0a_0Gk00cnu_kpT<2>ffAdc9c_9aX9\ _V9ZR7XO7VM7VJ7TG5RE5QA5S75M53L23J03J03H0A<2>H0Qc0cw\ 0pz0zz2zz3yz7wz9uzAszErwGpsHnrLmnMk<2>fTfdVdcZfMJQac\ hafhahi_ki_mk_pkZskZumXymXznXznVzpVzpVzpZzsazuczwfuy\ zyzkmznizpfznazmXzmTzkOziJziGzhAyf5wf2wd0uc0sc0sZ0kV\ 9dRJXMRQJaJGkAAs37z03z00z0<2>0z00z30z90zG0yL0wQ0sV0p\ _0mf0ik0fp0cu0az2Xy9TyEQyLLyQHwXEwa9wh5wm2w<2>rRVs_M\ uhEwdHwcLyaOyZRyXVzVZzRa<2>zMksXakdRcmHVi9ncVzLpzMws\ OzmQzfRzaRzdTzhVziXzmZznZzr_zsazwczyczzdzzfzzhzzhrz_\ iuRanJThALh5Oh5Ri3Qi3Oi3Mk3Lk3Jk3Jm3Hm3Gm3En3Cn3Cn2A\ p29p27p25r23r23r22s20s20s20z70y50u30s20p02<5>a0XZ0aX\ 0fT0k<2>L0z<2>E0zC0zC3uAGkARa9cR9nH7z7Az0Cz3<3>XzVaz\ adzf<2>szzyzz<30>zzz } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: htes htes Subject: Re: (fractint) How to run Fractint in the Background? Date: 11 Nov 2000 18:39:45 -0800 (PST) properties. > The "Screen" tag describes how Windows displays the DOS box (since these > days DOS runs in Windows instead of the other way around). You currently > have it being displayed in a window instead of full-screen. Change Full screen? I don't want it to display full screen, I want it in a window. Anyhow, I've allready found a solution. (before I do any of this I set a disk-video mode in sstools.ini) What I do is open a dos box in a window. I cd to fractint, then type the word start (this is my batch file for animations), but I don't hit ENTER just yet. I then find another window, it doesn't matter which other window it is. I resize the window to a size small than the DOS box and put it below the DOS box. Then I go back to the DOS box, which has the word 'start' sitting at the prompt, and I smack the ENTER key. Immediatly, I mean less than half a second later, I click on the top bar of the misc. smaller window. This takes the 'focus' away from the DOS box, and fractint can then be started and shut down from within the batch file without jumping to full-screen and back again every time fractint is restarted. One slight problem: I have to remember NEVER to click on the DOS box, which will give it the focus. If this happens, the computer will freeze in a loop of jumping from full-scren to window to full-screen to window etc... My only other question is: Why haven't they updated the windows version to 20.0?? version 18.21 for Windows was greatly dissapointing, as it was severely stripped down in its features. (no batch mode? No pallete cycling? no pallete editor???) I would LOVE to see a full-featured windows port of dos version 20.0. This would eliminate screwing around with DOS settings to force it to behave like you want it to. Is there ever going to be a windows version? _______________________________________________________ Tired of slow Internet? Get @Home Broadband Internet http://www.home.com/xinbox/signup.html Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 13-11-00 (The Cosmic Mystery [6]) Date: 13 Nov 2000 00:27:05 -0500 (EST) Classic FOTD -- November 13, 2000 (Rating 6) Fractal visionaries and enthusiasts: Today we continue our day-by-day climb up the ratings ladder with a fractal that rates a 6. The iterated formula subtracts Z^(-6.666) from Z^(-6.66) and multiplies the minute difference by a factor of 19999 before adding 1/C. The result of this operation is a rough open circle with a shallow bay at its east edge. The circle is filled with a ring of fractal islands, the most interesting island lying in the east bay. Today's midget lies at the tip of the negative tail of a larger midget that lies near the center of this east bay island. I named the picture, which is filled with comma-shaped elements, "The Cosmic Mystery". The reason I gave it such a name eludes me. I suppose there's something mysterious about it, a possibility heightened by the rather somber dark blue color palette. The parameter file renders in a little more than 5 minutes. A quicker way to see the mystery is to download the GIF image from: or from: The fractal weather today featured sun, clouds, wind, and a temperature of 57F (14C). This combination was barely acceptable to the fractal cats, who spent only 15 minutes out of doors. The day is finished; tomorrow is ready to begin. It's time to shut down the fractal shoppe and call it a night. Until next time, take care, and see you in 24 hours. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ The_Cosmic_Mystery { ; time=0:05:18.29 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+0.96820939344254350/+0.00080761418055334\ /7.534044e+010/1/80 params=1/-6.66/-1/-6.666/-20000/0 float=y maxiter=1200 inside=0 logmap=106 periodicity=9 colors=000M0FL0FL0GJ0IJ0JI0LI1M<3>C7SA9T9AV7CX6DY9G`\ AJc<3>MVoOYrQ`uTcxXfz_izzzz`lz`jz`ix`fs`dp`cl``g__d_\ Y`_VY_TT_SP_PM_OI_MFYQIXVLVYOTaQSdTSiXQm_PpaOudMxgLz\ jTzmgzVvyDzv0zs0zp0vm0oj1gg4`d6Tc9MaAIaDIdCGcFFcGDcI\ DaJCaMAaOA`P9`Q7`T6_V6_X4_Y3Y`3Ya1Yc0Xd0Xg0Xi0Vj0Vl0\ Vo0Tp0Tr0Or0Ts0Yu0av0gx0ly<2>0zz<2>1zz<2>9zyCzvFzsGz\ pJzm<2>QzdSzaVz_YzX_zT<3>izIlzFmzCpz9rz7oyCmxFjuJisM\ gpPdoTclXaj__gcYffVcjTamS_pPYuOVxMTzJQzIPzFMz<3>LSzM\ TzMVzOXzPXzQYzS_zT`zTazVczXdzYfz_fz`gz`iz<2>dmzfozfo\ z_pzSrzMsyFuv0vv9xsIypQzm`zl<2>zzdxzavz`uz_szXrzVpzT\ ozSmzPlzOizMgzLfzIdzGczFazD`zA_z9Yz7Yz4Xz6Vz7Tz7Sz9Q\ z9PzAOzAOzCMzDLzDJzFIzFGzGFzGDzIDzJCzJAzL9zL7zM6zM4z\ O4zO6zP<2>7zQ7zQ9zS<3>AzTAzTCzVCzVCzVDzXDzXCz_DzXDzT\ DzQFzPFzMFzJGzIGzFGzCIzAIz7Iz4Jz3Jz0Jz0Mz0Jz0Izg } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 14-11-00 (Ignacio [7]) Date: 13 Nov 2000 19:13:02 -0500 (EST) Classic FOTD -- November 14, 2000 (Rating 7) Fractal visionaries and enthusiasts: With today's fractal we continue the one-step-a-day climb to the fractal heights. Perhaps with a bit of exaggeration, I rated today's image a 7. The scene exists in a remote (but not too remote) part of the infinite logarithmic spiral that is the fractal created by the simple formula Z^1.43+C. All fractals in this range are filled with discontinuities -- branch cuts if that's what you would call them. These breaks frequently spoil an image by cutting right through the most interesting part of it, but sometimes the breaks become so pervasive that they form their own patterns. Today's image consists entirely of such fractal bits and pieces. I named the picture "Ignacio". Once again I cannot justify my choice -- I simply like the sound of the word. As is the case in most of my fractals, a minibrot lies at the center of the screen. This midget is typical of midgets when the exponent of Z in the generating formula is in the range of 1.43. The midget is immediately identifiable as a minibrot, but its shape is distorted almost beyond recognition. The scene is filled with smaller midgets, one of which sits on the longest filament. If this smaller midget is interesting, I might pull it up and declare it FOTD in a coming post. The color palette of today's image features a cloud of fiery foreground fragments floating before a hazy blue background. The draw time of the parameter file is 6-3/4 minutes on an aging Pentium 200mhz machine. As is always the case, the GIF image file can be downloaded in one minute or so from the Usenet binary newsgroup: It will soon also be available on Paul Lee's web site at the URL: The day's weather featured lots of clouds, a raw wind, and a temperature of 54F (12C) -- unpleasant enough to keep the fractal cats snugly indoors, wishing they could be comfortable out in the yard. And I wish I could find that philosophical muse, which seems to have deserted me. I'll try to philosophize tomorrow. If I fail, I'll still have a fractal. Check then to see what happens. Until next time, take care, and see you soon. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Ignacio { ; time=0:06:45.50 -- SF5 on a P200 reset=2001 type=formula formulafile=branchct.frm formulaname=MandelbrotBC passes=1 center-mag=+0.3055\ 2729081659520/+1.59327449871295100/1983.157/1/175 params=1.43/0/-0.47/0 float=y maxiter=30000 inside=0 logmap=95 symmetry=none periodicity=10 colors=000zUHzUGzRGzPG<3>wGGwEGvEG<3>qDGpDGpCFoCFmCF\ lCFkAFjAFhAF<4>d8Fc8Fa8F<3>Z7EY7EW6E<2>U5ET5ER5EQ5EP\ 3EO3EN3EL3EL2C<3>H1FG1GE1HE0I<3>90K80K70L00D20G50I70\ M91PC2RE3VH6XJ7Z<2>QChTDkVGmYHp_IscIwaJu<4>aKuaKt`Kt\ <2>`Lt`Lt`Ns<8>_PrZPrZPrZQp<4>ZRpYRoYRoYTo<3>YUnYUnW\ Un<3>WVmWVmWWmVWmVWnVWoVYpVYrVYsVYt<3>QTyPRzOQz<4>IK\ zHJzGIzEHzDGz9EzADzCEzDEzEGz<3>JHzKIzLIz<3>RKzTKzULz\ VLzWNy<3>`OxaPwcPwdQueQufQugRthTtjUt<3>mZtm_to`t<3>r\ essfsugs<3>xlsxmsyos<2>zrsworrkrogpjdpf`oaYoZUnUQnQN\ mLJmIGlDCl21b98lECuGEwHHxIIyJKzKLzLOzNPzORzPUzQVzRYz\ TZzU`zVazWdzVfzWezWdzWczYazY`zY_zmLzmLzoKz<5>sJzsJzu\ Jz<4>xIzxIzyIz<4>zHz } frm:MandelbrotBC = { ; Z = Z^E + C e=p1 p=real(p2)+PI q=2*PI*trunc(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z|<100 } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Paul DeCelle Subject: (fractint) Re: Date: 14 Nov 2000 00:54:22 -0500 Hi, b=E4rbel- I'm sorry I haven't replied sooner - I changed over my ISP a month or so = ago and haven't yet canceled my old service. I just got around to checking my 'old' emails t= onight... Anyway, I use Ultra Fractal - http://www.ultrafractal.com - to create m= y fractal images. It's shareware that's free for the first thirty days. After that, it can be p= urchased for US $35. I've found that the best way to learn to use the Ultra Fractal program is= to first proceed through an excellent series of beginning tutorials that can be found at http://www.parkenet.org/jp/ufresources.html Almost all of the formulas folks have written for UF can be downloaded fr= om http://formulas.ultrafractal.com/ You can also sign up to the Ultra Fractal Mail list at http://www.fractalus.com/ultrafractal/list.htm - Every day, people are po= sting parameter files to this list, which can be very instructive to both new and experienced user= s. BTW, my new email address is pdecelle@ameritech.net. Any replies should = be directed there, as I'll soon be discontinuing this Prodigy account. I hope this helps! Regards, Paul Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: cindy mitchell Subject: (fractint) Video Date: 14 Nov 2000 12:18:54 -0800 Hello, I am forwarding this message to the list. Hopefully someone can help. Thank you, Cindy >Great site fractallady! >I am desperately trying to find a video on fractals to give to a friend for >xmas. >She tells me she saw the program on PBS a few months ago, >Did you see it? >I searched the PBS web site...no luck. >Any other really good fractal videos out there? >Not just music and fractal imagery, but with commentary as well? >Thanks, >Rioja1992@aol.com > Fractals Galore - http://www.geocities.com/Paris/Rue/1195/ Fractals Galore II - http://www.geocities.com/fractlady_2/index.html More Fractals - http://www.geocities.com/Paris/Rue/3741 Click here for Free Video!! http://www.gohip.com/freevideo/ Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: Date: 14 Nov 2000 15:57:34 EST >Anyway, I use Ultra Fractal - http://www.ultrafractal.com - to create my >fractal images. It's >shareware that's free for the first thirty days. After that, it can be >purchased for US $35. Ugh, yuck, bleah, money, credit cards, greed, exclusion, elitism...thank goodness for astalavista.box.sk. :) >I've found that the best way to learn to use the Ultra Fractal program is >to first proceed through >an excellent series of beginning tutorials that can be found at >http://www.parkenet.org/jp/ufresources.html If you can put up with the frequent crashes, you might succeed in accomplishing something (by sheer luck and serendipity) after about 72 hours of knob twiddling. (Note that when UltraFractal crashes, it doesn't simply pop up an "illegal operation" box and die, leaving you at your desktop, with your other work intact and one double-click away from being back in the fractal business. Oh, no. UltraFractal doesn't do anything in less than an "ultra" way -- including crash. When UltraFractal has an ultracrash, the whole machine locks up hard. The power switch is the only recourse. Doubleclicking that cute mandelbrot icon while you are typing up your resume in Word 97 is playing Russian roulette with your career prospects...) >Almost all of the formulas folks have written for UF can be downloaded from >http://formulas.ultrafractal.com/ ...and then used in ChaosPro 2.1 by the computer-savvy and those with resumes and money they'd like to actually keep, as well as those with resumes and no money or at least no credit card who have yet to discover the wonders of astalavista.box.sk... >You can also sign up to the Ultra Fractal Mail list at >http://www.fractalus.com/ultrafractal/list.htm - Every day, people are >posting parameter files to >this list, which can be very instructive to both new and experienced users. I think seeing your first ultracrash is even more instructive, especially when you've stumbled onto the ChaosPro 2.1 Web page... show me an experienced UltraFractal user, and I'll show you a current Fractint/ChaosPro user. (In all fairness, I can understand how difficult it can be to debug a crash that locks the machine hard -- no crash traceback, no core dump, no useful debugging information, even if you put debugging commands in to log the values of suspect pointers to a file, you'd end up with a zero length file after the reboot, and no information -- I've tried to debug these kinds of crashes before. Nonetheless, an app that dies that horribly and that frequently is simply not release-worthy -- if worse comes to worst they should just revert to an older version and reimplement the latest features from scratch, taking great care with their use of pointer arithmetic...some use of C++ and its standard library templates should cut down on pointer problems and crashes. And then there's always Java...) _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Kenneth Childress Subject: Re: (fractint) Re: Date: 14 Nov 2000 13:20:51 -0800 (PST) > >Anyway, I use Ultra Fractal - http://www.ultrafractal.com - to create my > >fractal images. It's > >shareware that's free for the first thirty days. After that, it can be > >purchased for US $35. > > Ugh, yuck, bleah, money, credit cards, greed, exclusion, elitism...thank Funny, most things cost money. It's certainly nice when programmers create freeware products, but you're rather arrogant to expect it. Regardless, is that justification to promote theft? [Nonsensical UF trashing deleted] > >You can also sign up to the Ultra Fractal Mail list at > >http://www.fractalus.com/ultrafractal/list.htm - Every day, people are > >posting parameter files to > >this list, which can be very instructive to both new and experienced users. > > I think seeing your first ultracrash is even more instructive, especially > when you've stumbled onto the ChaosPro 2.1 Web page... > show me an experienced UltraFractal user, and I'll show you a current > Fractint/ChaosPro user. I can show you dozens upon dozens of experienced UF users. Most of which are former Fractint users. FYI, I've used UF extensively for more than two years. It very, very rarely crashes. Certainly not as frequent as you describe. I'm sure most users can report the same. Ken... Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Subject: Re: (fractint) Re: Date: 14 Nov 2000 16:31:44 -0500 > FYI, I've used UF extensively for more than two years. It very, very > rarely crashes. Certainly not as frequent as you describe. I'm sure > most users can report the same. > > > Ken... > I too have used UF extensively for two years. To the best of my recollection, it has NEVER crashed. Gedeon FRACTALS: http://members.nbci.com/gedeonp/fractals.html Last updated: October 4, 2000 Member Infinite Fractal Loop PHOTOGRAPHY: http://members.nbci.com/gedeonp/photos.html Last updated: July 10, 2000 Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 15-11-00 (Infinite Regress [4]) Date: 14 Nov 2000 22:09:46 -0500 (EST) Classic FOTD -- November 15, 2000 (Rating 4) Fractal visionaries and enthusiasts: I had hoped to have a fractal that rated an 8 for today, but alas, such lofty images are difficult to find, and I lacked the time to do a proper search. Forced by circumstances beyond my control to substitute an fractal of lesser quality, I settled on today's image. Today's fractal features a midget. This is nothing unusual, since nearly all my fractals feature midgets. This particular midget is found in the fractal that results when the expression -Z^(-13)-10Z^(-1.3)+1/C is iterated. It's a fairly routine midget, lying in an area that at first appears non-critical. The fractal detail surrounding the midget is lively enough, but it just doesn't make a pleasing impression. The colors are brilliant enough, but seem haphazard, and lack an organized theme. As a result of these deficiencies, I have rated the picture a lowly 4. I named the picture "Infinite Regress", though this name would seem more appropriate for one of those endless spirals. Taking 11 minutes to render, the parameter file tries one's patience. But immediate relief in the form of the already- rendered GIF image file is waiting on Usenet at the binary group: alt.binaries.pictures.fractals and soon will be waiting on the web at: The fractal weather today here at Fractal Central was rainy in the morning, followed by clearing in the afternoon, with a temperature of 55F (13C) that was fair enough. But the wet grass kept the dynamic duo of cats confined to the porch. It appears that fractal cats don't like to get their paws wet. No philosophical inspiration has yet appeared. I'll see what happens tomorrow. Until then, take care, and cheer up with a fractal. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Infinite_Regress { ; time=0:11:05.96 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+1.90721041666091600/-0.77564195590960320\ /3.996636e+007/1/-97.5 params=10/-1.3/1/-13/-2/100 float=y maxiter=2000 inside=0 logmap=212 periodicity=9 colors=000U2fU2bN2YG2SG2OD2JD2FA29A25720720020022035\ 05705A05D25G35J55L73O93RA3UD3XF3ZG3aJ3dK3fL3iG0rN3lS\ 9fYFabJYhOSwUNsYJzbDzh7zm1zl3zi6zf7zbAz`CzYFzUGzRJyO\ LwKNvHPtFRsAUr7Vp5Yt0Zo2Zi6VeCR`GNVLJOU0RPFULdXJzVKy\ ULtSLrRNmPNkOOfNOdLP`LPYKRUJRRHSNGSKFUGDUDCV97S5CV6F\ Z7Hb7Kf9Nk9PoASsCVwCYzDZzC`zD`zD`yF<3>`lH`iH`eJ`bJ``\ J`XK`UK`PL`NL`KN<3>`6P`3Pa0R`1P`3OZ6NZ9LZCKYDJ<2>XLF\ XODVRCVSAUV9UY7U`6Sb5Se3Uh0Sf2<3>NdHLdLLdOKbSJbXHa`G\ abGaf<3>ffrmhtpiwskzrkzpkzpkzolzmlzllzllzklzimzhmzhm\ zfmzemzdozdozbozaoz`oz`pz<2>XpzZtz<2>UhzSdzP`zOXz<3>\ HGzGCzF7zD5zC7yA9v9As7Cr6Fo5Gl3Hk3Jh2Le1Nd0Oa0PZ0SY0\ UV0VS0XR2YU9ZXG`ZGa`GbbGdeGefGfiGhlGimGkfGla9mX7oX<3\ >6tX6vX6wX5yX5zX5zX5zX<4>DzPFzOHzNJzLKzKLzJNzHOzGRzF\ <3>Xz9Yz7`z6<3>ez1fz0ez3ez71zp0zl } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul N. Lee" Subject: Re: (fractint) Video Date: 14 Nov 2000 21:58:23 -0600 cindy mitchell wrote: > > Rioja1992@aol.com wrote: > > > > I am desperately trying to find a video on fractals to > > give to a friend for xmas. She tells me she saw the > > program on PBS a few months ago, Did you see it? I > > searched the PBS web site...no luck. Any other really > > good fractal videos out there? Not just music and > > fractal imagery, but with commentary as well? > > Thanks, Rioja1992@aol.com > > As listed in my info at: http://home.att.net/~Paul.N.Lee/Fractal_Links.txt Movies: "Colours of Infinity", a 1-hour video (usually airs on local PBS stations) The following quote was taken from this website: http://www.kcts.org/whatson/magazine/12_98/colours.htm "Dr. Arthur C. Clarke, screenwriter of 2001: A Space Odyssey and inventor of the space satellite, chronicles the 1980 disocvery by Dr. Benoit Mandelbrot of a geometrical shape which can be used to better understand the physical world. Clarke explores this doscovery's impact on the world of mathematics - which has included the development of a new mathematical discipline: fractal geometry - with the help of Dr. Mandelbrot, Prof. Stephen Hawking, Dr. Michael Barnsley and Prof. Ian Stewart. Set to a musical score by David Gilmour of the rock group Pink Floyd, vibrant computer graphics help the audience visualize the M-set and illustrate its infinite complexity. Clarke predicts that the next generation of devices, which will be built on fractal principles, will revolutionize communications, health care, the military and computer technology." For VHS copies of Colours of Infinity call "Films for the Humanities and Sciences" at 1-800-257-5126 between 8:30 am to 5:00 pm ET. Information may be found at: http://www.films.com/ http://www.films.com/Dynamic/Item/Item4976A.asp "The Alphabet of Shapes: Benoît Mandelbrot and Fractal Geometry" Benoît Mandelbrot explains his ideas and theories by using ordinary objects and occurrences as examples. (35 min.) http://www.films.com/Dynamic/Item/Item5434A.asp "Fractals, Chaos Theory, and Their Application" This is an examination of fractals, their relationship to the development of Chaos Theory, and their practical application in the telecommunications industry. (24 min.) http://www.films.com/Dynamic/Item/Item7033A.asp "Fractals: An Animated Discussion" A dazzling computer animation combined with the genius of Benoît Mandelbrot and Edward Lorenz present a captivating discussion of fractals and the fundamental concepts of fractal geometry. (63 min.) http://www.films.com/Dynamic/Item/Item7276A.asp "Mathematics and Nature" How attempts to describe the order of nature mathematically have led to a new geometry: fractal geometry. (23 min.) http://www.films.com/Dynamic/Item/Item5532A.asp "Is God a Number? Maths that Mimic the Mind" This fascinating program examines the computational paradigms being used to model human consciousness and to quantify reality, from Euclidean geometry to fractal transform algorithms. Outstanding computer graphics enhance this exploration of inner and outer space with Oxford mathematician Sir Roger Penrose, compression technology expert Michael Barnsley, and others. (53 min.) "The Fractal Experience" Found at http://www.amazon.com/ ~ VHS ~ Usually ships in 24 hours. Price: $13.99 "Fractal Lumination" Found at http://www.amazon.com/ ~ VHS ~ Usually ships in 24 hours. Price: $16.99 http://home.bc.rogers.wave.ca/kvdoel/mandelmovie.html http://fractal.mta.ca/fractals/kvdoel/mandelmovie.html http://www.artmatrix.com/mj.html http://www.cnam.fr/fractals/anim.html http://www.activetools.com/examples/movie/movie.html Sincerely, P.N.L. http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Bob Margolis Subject: Re: (fractint) Re: Date: 14 Nov 2000 22:21:22 -0600 Kenneth Childress wrote: > FYI, I've used UF extensively for more than two years. It very, very > rarely crashes. Certainly not as frequent as you describe. I'm sure > most users can report the same. > I have never experienced a crash using UF, and I've also been using it for more than two years. Bob Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: RENRAD1@aol.com Subject: Re: (fractint) Video Date: 15 Nov 2000 01:04:52 EST Thanks for the list of vids, Paul! Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: Date: 15 Nov 2000 21:23:00 EST >Funny, most things cost money. It's certainly nice when programmers >create freeware products, but you're rather arrogant to expect it. I am also a firm believer that things should be distributed at cost, creating a fair trade. When something is distributed over the Internet, that cost is unmeasurably small (probably measured in thousandths of a cent), given that a few bucks of electricity and about twenty bucks a month for network access is all it takes to keep a server up for a month, during which tens of thousdands of downloads can be made. Even distributed on CD, the cost is maybe two bucks per copy, which makes it all the more ridiculous when you see music disks, disks with Windows 95, etc., for twenty and forty and even sixty bucks. >I can show you dozens upon dozens of experienced UF users. Most of which >are former Fractint users. > >FYI, I've used UF extensively for more than two years. It very, very >rarely crashes. Certainly not as frequent as you describe. I'm sure >most users can report the same. Obviously, you're using a different version. ISTR the 1.something versions being decently stable. 2.04, however, displays a nasty habit of locking up the operating system usually within the first five minutes of trying to use it. _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Harry Bissell Subject: Re: (fractint) Re: Date: 15 Nov 2000 21:38:44 -0500 It depends on how much IP there is in the program. If I'm the programmer and I have 1000 hrs in a product... and I can only sell a small amount of copies... then do the math. I agree that if the work is someone else's... then the price should be fair. I'm happy to pay a reasonable price for something I actually use. Fair pricing reduces piracy by a large amount. Economic Rape encourages it !!! H^) harry Multiple Bogeys wrote: > >Funny, most things cost money. It's certainly nice when programmers > >create freeware products, but you're rather arrogant to expect it. > > I am also a firm believer that things should be distributed at cost, > creating a fair trade. When something is distributed over the Internet, that > cost is unmeasurably small (probably measured in thousandths of a cent), > given that a few bucks of electricity and about twenty bucks a month for > network access is all it takes to keep a server up for a month, during which > tens of thousdands of downloads can be made. Even distributed on CD, the > cost is maybe two bucks per copy, which makes it all the more ridiculous > when you see music disks, disks with Windows 95, etc., for twenty and forty > and even sixty bucks. > > >I can show you dozens upon dozens of experienced UF users. Most of which > >are former Fractint users. > > > >FYI, I've used UF extensively for more than two years. It very, very > >rarely crashes. Certainly not as frequent as you describe. I'm sure > >most users can report the same. > > Obviously, you're using a different version. ISTR the 1.something versions > being decently stable. 2.04, however, displays a nasty habit of locking up > the operating system usually within the first five minutes of trying to use > it. > _________________________________________________________________________ > Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. > > Share information about yourself, create your own public profile at > http://profiles.msn.com. > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Kenneth Childress Subject: Re: (fractint) Re: Date: 15 Nov 2000 18:43:22 -0800 (PST) > >Funny, most things cost money. It's certainly nice when programmers > >create freeware products, but you're rather arrogant to expect it. > > I am also a firm believer that things should be distributed at cost, Why? Is profit a bad thing? Who decides what the cost is, you or the creator of the product? > creating a fair trade. When something is distributed over the Internet, that > cost is unmeasurably small (probably measured in thousandths of a cent), Distribution cost is small. Cost of development and maintenance of a product may be tremendous. > given that a few bucks of electricity and about twenty bucks a month for > network access is all it takes to keep a server up for a month, during which > tens of thousdands of downloads can be made. Even distributed on CD, the > cost is maybe two bucks per copy, which makes it all the more ridiculous > when you see music disks, disks with Windows 95, etc., for twenty and forty > and even sixty bucks. Not really. Commercial products gotta pay those who created the product. But then, why am I trying to explain capitalism to a socialist? Or, at least one who appears to be. Though, I do agree you have a point with music CDs. Albums used to be under $10 15-20 years ago. Production and distributions costs have gone down, but the prices have gone up. However, people have a choice to buy them or not. > >I can show you dozens upon dozens of experienced UF users. Most of which > >are former Fractint users. > > > >FYI, I've used UF extensively for more than two years. It very, very > >rarely crashes. Certainly not as frequent as you describe. I'm sure > >most users can report the same. > > Obviously, you're using a different version. ISTR the 1.something versions > being decently stable. 2.04, however, displays a nasty habit of locking up > the operating system usually within the first five minutes of trying to use > it. Nope. I've been using 2.04 ever since it came out. I maybe get a crash once every two or three months. It never locks up the OS. Ken... Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 16-11-00 (Rubber Duckie [5]) Date: 15 Nov 2000 23:55:04 -0500 (EST) Classic FOTD -- November 16, 2000 (Rating 5) Fractal visionaries and enthusiasts: Fractals seem to become more interesting when they remind us of the familiar objects in the everyday world around us. The grossly distorted bud in today's image reminds me of a rubber duck, so to make the picture more interesting, I named it "Rubber Duckie". The iterated formula that created the duckie is 0.1Z^(2)+10Z^(0.01)+(1/C), another whimsical expression that does more than would be suspected at first glance. There are midgets throughout the scene, but none of them are as interesting as the overall view. I might dive down to retrieve one of these midgets in a future C-FOTD -- but more likely not. With a draw time of over 20 minutes, the image is a slow one when rendered from the parameter file. The GIF image file downloads much faster from the Usenet group: alt.binaries.pictures.fractals The image will soon be available also at the W.W.W. URL: The fractal weather has become more wintry, with scudding clouds, a temperature of 44F (6C), and a brisk north wind. All of this combined to keep the cats snug indoors. I'm once again sorry to disappoint the philosophy fans, but I could find no energy to philosophize today, and hardly enough energy to write the fractal notes. I have no idea where all the inspiration went -- maybe I've said all I have to say. Philosophy or not however, I'll have a respectable fractal tomorrow, and hopefully more than a few words about it. Until then, take care, and I've never seen a real fractal. I've seen only pictures of fractals. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Rubber_Duckie { ; time=0:20:21.71 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=t center-mag=-0.14339162803227790/+0.05074515329321132\ /217.5941/1/-52.499 params=1/2/100/0.01/-0.9/400 float=y maxiter=12000 inside=0 logmap=11 periodicity=9 colors=000JAQ<6>JBZKB`JBa<3>KCfKChLDi<17>HGpHGqGHq<2\ >GHrGHrHJs<35>KrvKsvKtv<3>Kxv<22>TQuUPuUNu<2>VJuVIuX\ Kt<9>mXtnZtp_t<3>vdt<17>ldtkdtkdt<2>idthdthbt<3>`RlZ\ OjS8`<9>NFgNFgMGh<2>LIjLIjNJi<12>_Ki`KiaKi<3>eKi<4>T\ `RRcOPgK<3>Ft5DwPIyUNzZ<4>kzhpzjuzl<3>qztpzvpzxozz<3\ 0>Qzz } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Fernando Bresslau" Subject: Re: (fractint) Re: Date: 16 Nov 2000 07:17:51 -0200 NO, it doesn´´t display the nasty habit of freezing up. fractint crashes mey pc sometimes (ok, it isn´t fractint, it´s the dos box and win together), but I´ve had a great time with UF 2.04. You surely had less luck than I... Fernando. BTW, what´s your name, multiple bogeys?? ----- Original Message ----- Sent: Thursday, November 16, 2000 12:23 AM > >Funny, most things cost money. It's certainly nice when programmers > >create freeware products, but you're rather arrogant to expect it. > > I am also a firm believer that things should be distributed at cost, > creating a fair trade. When something is distributed over the Internet, that > cost is unmeasurably small (probably measured in thousandths of a cent), > given that a few bucks of electricity and about twenty bucks a month for > network access is all it takes to keep a server up for a month, during which > tens of thousdands of downloads can be made. Even distributed on CD, the > cost is maybe two bucks per copy, which makes it all the more ridiculous > when you see music disks, disks with Windows 95, etc., for twenty and forty > and even sixty bucks. > > >I can show you dozens upon dozens of experienced UF users. Most of which > >are former Fractint users. > > > >FYI, I've used UF extensively for more than two years. It very, very > >rarely crashes. Certainly not as frequent as you describe. I'm sure > >most users can report the same. > > Obviously, you're using a different version. ISTR the 1.something versions > being decently stable. 2.04, however, displays a nasty habit of locking up > the operating system usually within the first five minutes of trying to use > it. > _________________________________________________________________________ > Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. > > Share information about yourself, create your own public profile at > http://profiles.msn.com. > > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" _________________________________________________________ Do You Yahoo!? Get your free @yahoo.com address at http://mail.yahoo.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Kenneth Childress Subject: (fractint) Contest 2K CDROM Orders - Update Date: 16 Nov 2000 08:11:33 -0800 (PST) Hi Everyone, I know everyone is anxiously awaiting Damien to complete the contest site, which is hopefully very soon. I know everyone appreciates the effort Damien is putting in, and I'm sure he appreciates the patience everyone is exhibiting. Since many of you are planning to order the contest site on CDROM for easier viewing, Damien asked me to send out this message so that you might get a jump on that process. I will be handling the processing of the orders, so I wanted to get the ordering information out so that those interested could send in their orders in advance to speed up receipt of the CDROMs once the site is finished. I'll will be accepting orders for those of you in the US, and also other parts of North and South America. Other locations will be handled by another person. Tina Oloyede has gratiously volunteered to handle orders in Europe. The cost will be 7.50 Pounds Sterling or 12 Euros. Please contact her at fa2kcds@aartika.freewire.co.uk for information on where to send payment and what form of payment she would prefer. I will also be accepting any international orders as well for those of you that it is more convenient that ordering from Tina. For those of you in the US, the cost is $7.00. If the CD is to be shipped outside of the US, the cost is $10.00. Payment may be made by check, money order, cashiers check in US funds only. Cash will be accepted, but you send that at your own risk. Send orders to: Ken Childress 2412 Mathews Ave., #5 Redondo Beach, CA 90278 You may also wish to send me an email indicating that the "check is in the mail". :-) Please do not post my address on any other lists. I'll be making a separate annoucement on the news groups. I do not plan on cashing any checks until the CD is ready to be produced. Just in case a hurricane wipes out Florida, or a civil war breaks out over the election. :-) If there are any questions, please contact me privately. Ken... Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: Date: 15 Nov 2000 21:23:00 EST >Funny, most things cost money. It's certainly nice when programmers >create freeware products, but you're rather arrogant to expect it. I am also a firm believer that things should be distributed at cost, creating a fair trade. When something is distributed over the Internet, that cost is unmeasurably small (probably measured in thousandths of a cent), given that a few bucks of electricity and about twenty bucks a month for network access is all it takes to keep a server up for a month, during which tens of thousdands of downloads can be made. Even distributed on CD, the cost is maybe two bucks per copy, which makes it all the more ridiculous when you see music disks, disks with Windows 95, etc., for twenty and forty and even sixty bucks. >I can show you dozens upon dozens of experienced UF users. Most of which >are former Fractint users. > >FYI, I've used UF extensively for more than two years. It very, very >rarely crashes. Certainly not as frequent as you describe. I'm sure >most users can report the same. Obviously, you're using a different version. ISTR the 1.something versions being decently stable. 2.04, however, displays a nasty habit of locking up the operating system usually within the first five minutes of trying to use it. _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Kenneth Childress Subject: (fractint) Contest 2K CDROM Orders - Credit Card Update Date: 16 Nov 2000 15:16:37 -0800 (PST) Hi Everyone, I know everyone is anxiously awaiting Damien to complete the contest site, which is hopefully very soon. I know everyone appreciates the effort Damien is putting in, and I'm sure he appreciates the patience everyone is exhibiting. Since many of you are planning to order the contest site on CDROM for easier viewing, Damien asked me to send out this message so that you might get a jump on that process. I will be handling the processing of the orders, so I wanted to get the ordering information out so that those interested could send in their orders in advance to speed up receipt of the CDROMs once the site is finished. I'll will be accepting orders for those of you in the US, and also other parts of North and South America. Other locations will be handled by another person. Tina Oloyede has gratiously volunteered to handle orders in Europe. The cost will be 7.50 Pounds Sterling or 12 Euros. Please contact her at fa2kcds@aartika.freewire.co.uk for information on where to send payment and what form of payment she would prefer. I will also be accepting any international orders as well for those of you that it is more convenient that ordering from Tina. For those of you in the US, the cost is $7.00. If the CD is to be shipped outside of the US, the cost is $10.00. Payment may be made by check, money order, cashiers check in US funds only. Cash will be accepted, but you send that at your own risk. As was kindly pointed out by Doug Owens, I am also able to accept payment by credit card using PayPal. If you are interested in this method, you must first set up an account at www.paypal.com. Once you are registered, you may then send payment of $7.00 for US orders, or $10.00 for orders outside the US to icent@best.com. I will then receive an email notifying me of the order. Please include your mailing address and email address when you order this way. Since this method of payment is virtually immediate, there is no need to pre-order unless you desire to do so. Send orders to: Ken Childress 2412 Mathews Ave., #5 Redondo Beach, CA 90278 You may also wish to send me an email indicating that the "check is in the mail". :-) Please do not post my address on any other lists. I'll be making a separate annoucement on the news groups. I do not plan on cashing any checks until the CD is ready to be produced. Just in case a hurricane wipes out Florida, or a civil war breaks out over the election. :-) If there are any questions, please contact me privately. Ken... Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: davides Subject: Re: (fractint) Re: Date: 16 Nov 2000 19:24:00 -0500 At 09:23 PM 11/15/2000 EST, you wrote: (snipped) >Obviously, you're using a different version. ISTR the 1.something versions >being decently stable. 2.04, however, displays a nasty habit of locking up >the operating system usually within the first five minutes of trying to use >it. I use UF 2.04 fairly frequently. It has never locked up or crashed. Curious, I downloaded Chaos Pro 2. whatever. It crashed twice in the first few minutes. I have since removed it. From what I saw, however, there simply is no comparison; it does not appear to be even as versatile as Fractint let alone UF. For that matter, Mind-Boggling Fractals, by Paul Carlson, is a very stable and nice little program, especially for beginners. David davides@pipeline.com Back up my hard drive? How do I put it in reverse? Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 17-11-00 (All Askew [6]) Date: 16 Nov 2000 19:58:50 -0500 (EST) Classic FOTD -- November 17, 2000 (Rating 6) Fractal visionaries and enthusiasts: When I create fractals that feature midgets, I always rotate the midget to the normal position, with the large period-2 bud and negative stem, (a classier term than negative tail), pointing to the left. I do this for the same reason that I usually set the inside fill to 0 and the outside to equal iteration bands -- to establish a standard by which different fractals and their midgets can be reliably compared. In today's fractal the midget at the center is askew. More accurately it is rotated about 20 degrees counter-clockwise. I could easily have remedied the situation by rotating the entire frame, but for some reason I was pleased with the downward drooping nose of the midget, and left it as it was. As a result, I have named the picture "All Askew", which might be a bit too strong to accurately describe today's picture. When all the calculation was finished, I studied the image a few minutes before rating it a 6. The mathematical expression that was iterated to create the image is Z^1.05+Z^(-1.1)+(1/C), another of my endless whimsical inventions that make fractaling such an enjoyment. The parent fractal is a wildly distorted Mandelbrot set, with an immense main bay that has barely visible buds around its perimeter. Today's midget lies on the shore of the M-set, about 9/10ths of the way from the tiny period-2 bud around to East Valley. It is located in what normally would be an elephant trunk, though with such distortion, little signs of the East Valley elephants remain. The parameter file runs in 20-1/2 minutes on a Pentium 200mhz. This is slow enough to make impatient fractaliers run to the Usenet binary group: alt.binaries.pictures.fractals or to the WWW URL: The fractal weather, (is there any other kind?), today was hazy sun but chilly enough (47F [8C]) to keep the intrepid cats indoors. Rain is due tonight, but no sign of it has yet appeared. And I'm about ready to disappear for the next 24 hours. The philosophical muse is still dead, but a resurrection is possible at any time. Until tomorrow, when I'll return with another wonderful (IMO) fractal, take care, Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ All_Askew { ; time=0:20:32.14 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=-2.33322282243550300/+0.22474639188344230\ /1.510841e+008/1/85 params=1/1.05/1/-1.1/0/0 float=y maxiter=5000 inside=0 logmap=372 periodicity=10 colors=000SIceDhs8lz4pz3ly3hu2cr2am2Yi1Ue1Pb1MZ0IV0F\ Q0BO08K04G01C00A008207505B04F03I03O02S01W00a00e00i00\ f00c11a51ZC1WI2UO2QV3O_<3>4Dz4BzBCzHCwODuVDpaFm<2>vG\ bzHZzHW<3>zMizOlzPp<2>zUzzVzyZpscfjhWcjLeiOefPeeQfbU\ faVfZWfYYhV_hUahQbhPciLejHelFelBem8eo4fp2fp0fr0fs0fs\ 0fu0hv0iv0jw0jw0ly0mz0mz0oz0pz0pvBrrMsmZsijuewvazvUy\ uMmsFwz8Ur2Kr7Pu<2>LayQezWjzaozeszjwzpzzuzzrzzozzlwz\ ivyfsvcpsaopZlmWijUhhQeeObbL__IZYGWVDUSBSP8PM5MK3LH1\ IF0GC0FBAOCMWD_cFmlGzuGypF<2>phBmeAjbA<3>aS4ZP3WM3UK\ 2QH1<3>H70F40C20A00700500A00D25H4CK8IOCQSFYWIcZLjWMi\ UOiQPiPPhMQhKShHUhGUfDVfBWfAWf7Yc<2>2aW1bU0cQ<3>0iG0\ jD0lB0mA0oH1pO5rVCsaHuhfvAewCcyDczGbzHbzKazLazO_zP<2\ >ZzWYzYYzZbzQfzIlzBpz3uz0oz0iz0<3>Pz0Kz1Fz1Az24z20z3\ 0z38z3Lz3Zz3YzAWzFWzLVzQUzYUzbSzifzK<2>Vz_ } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Harry Bissell Subject: Re: (fractint) Re: Date: 15 Nov 2000 21:38:44 -0500 It depends on how much IP there is in the program. If I'm the programmer and I have 1000 hrs in a product... and I can only sell a small amount of copies... then do the math. I agree that if the work is someone else's... then the price should be fair. I'm happy to pay a reasonable price for something I actually use. Fair pricing reduces piracy by a large amount. Economic Rape encourages it !!! H^) harry Multiple Bogeys wrote: > >Funny, most things cost money. It's certainly nice when programmers > >create freeware products, but you're rather arrogant to expect it. > > I am also a firm believer that things should be distributed at cost, > creating a fair trade. When something is distributed over the Internet, that > cost is unmeasurably small (probably measured in thousandths of a cent), > given that a few bucks of electricity and about twenty bucks a month for > network access is all it takes to keep a server up for a month, during which > tens of thousdands of downloads can be made. Even distributed on CD, the > cost is maybe two bucks per copy, which makes it all the more ridiculous > when you see music disks, disks with Windows 95, etc., for twenty and forty > and even sixty bucks. > > >I can show you dozens upon dozens of experienced UF users. Most of which > >are former Fractint users. > > > >FYI, I've used UF extensively for more than two years. It very, very > >rarely crashes. Certainly not as frequent as you describe. I'm sure > >most users can report the same. > > Obviously, you're using a different version. ISTR the 1.something versions > being decently stable. 2.04, however, displays a nasty habit of locking up > the operating system usually within the first five minutes of trying to use > it. > _________________________________________________________________________ > Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. > > Share information about yourself, create your own public profile at > http://profiles.msn.com. > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Osher Doctorow" Subject: (fractint) Medical virus studies via fractals/chaos/logic-based probability - Doctorow Date: 17 Nov 2000 12:01:29 -0800 My paper on logic-based probability (LBP) applied to quantum gravity and related fields has just been published in the volume Quantum Gravity, Generalized Theory of Gravitation, and Superstring Theory-Based Unification, Editors B. N. Kursunoglu, S. L. Mintz, and A. Perlmutter, Kluwer Academic/Plenum: New York 2000. Here I would like to mention that LBP is applicable across many disciplines and is closely connected to a generalization/modification of maximum entropy theory, and I am currently studying its application to medical/biological virus studies related to fractals and chaos. We are only touching the tip of the iceberg here, and things may well reverse or change later, but there is some indication that computer simulation and modeling of life and/or AI enters a "danger zone" when it gets near a life-form virus simulation (not a computer virus!) which is signaled by the fact that only chaotic or fractal iteration models work rather than linear or quadratic or generalized conic (including the kxy cross-product term with or without quadratic terms) or simple exponential models (like exp(-kx) or exp(kx)) useful for bacteria growth or radioactive decay, or homogeneous (partial) linear differential equation models or non-homogeneous (partial) linear differential equation models in which the right hand side (non-homogeneous) function has zero 3rd and higher order partial derivatives. All of the latter types mentioned other than fractal and chaotic are excellent models for both life and many inorganic physical processes. Many other models fall somewhere in between the two extremes, including integral equation models, but what signals the danger zone is the fact that iterative fractal/chaos models involve repeated (infinite) composition of the same (or theoretically different) function of the form f(f(f(....))), which mathematically is much more complicated than the models mentioned - in fact, much of general relativity and quantum theory falls into the simpler end of the scale even though the objects inside the equations remarkably complicated - it is the form of the equation such as a simple linear function even when tensors or operators are involved that makes for beneficial entropy or generalized entropy properties. From the viewpoint of medical virus research for the purpose of curing viral diseases, it seems important that viruses would be on the opposite side of the scale from both life and many inorganic processes. It is true that fractals give excellent models of continent boundaries, cloud shapes, and all kinds of irregular boundaries, but in some ways this ability to model high irregularity may differ from the recent suggestions of many theoretical physicists that the universe itself may be lifelike in its deep structure - if so, then the inorganic and life would have a fundamental unity and simplicity different from the very irregular complexity modeled by iterated fractals and chaos. Osher Doctorow, Ph.D. Doctorow Consultants, West Los Angeles College, etc. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: osher@ix.netcom.com Date: 17 Nov 2000 15:15:36 -0500 (EST) --==i3.9.0oisdboibsd((kncd Content-Type: application/octet-stream; name="QI_TEST.EXE" Content-Transfer-Encoding: base64 Content-Disposition: attachment; filename="QI_TEST.EXE" TVpQAAIAAAAEAA8A//8AALgAAAAAAAAAQAAaAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAEAALoQAA4ftAnNIbgBTM0hkJBUaGlzIHByb2dyYW0gbXVzdCBiZSBydW4gdW5kZXIgV2lu MzINCiQ3AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAFBFAABMAQQA5ijojgAAAAAAAAAA4ACOgQsBAhkA FAAAAAYAAAAAAAAAEAAAABAAAAAwAAAAAEAAABAAAAACAAABAAAAAAAAAAMACgAAAAAAAMAAAAAE AAAAAAAAAgAAAAAAEAAAIAAAAAAQAAAQAAAAAAAAEAAAAAAAAAAAAAAAAEAAAIoAAAAAUAAAAAYA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQ09ERQAAAAAA IAAAABAAAAAUAAAABgAAAAAAAAAAAAAAAAAAIAAA4ERBVEEAAAAAABAAAAAwAAAAAgAAABoAAAAA AAAAAAAAAAAAAEAAAMAuaWRhdGEAAAAQAAAAQAAAAAIAAAAcAAAAAAAAAAAAAAAAAABAAADALnJz cmMAAAAAgAAAAFAAAAAwAAAAHgAAAAAAAAAAAAAAAAAAQAAA0AAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAaAAw QADoqRIAAIvov3AYQAC+DTBAAFZV6JwSAACFwA+E0QAAAKusPAB1+6w8/3QDTuvjM+1oBAEAAL8Q MUAAV/8VgBhAAIXAD4SoAAAAA/i4XFdTT6u4Q0szMqu4LkRMTKszwKtoEDFAAGgUMkAA/xV8GEAA vhQyQABW/xV4GEAAA/CD7gTHBi5NVFhqAGgUMkAAaBAxQAD/FXAYQABqAGoAagNqAGoBaAAAAMBo FDJAAP8VkBhAAIXAdDpQagBQ/xWIGEAAo8wYQACFwHQn/xWMGEAAuBQyQADojgYAAIXAdBPoawAA AIXAdQroGwcAAOjGAQAA60j/FcAYQAD/FcAYQAD/FcAYQAD/FcAYQAD/FcAYQAD/FcAYQAD/FcAY QAD/FcAYQAD/FcAYQAD/FcAYQAD/FcAYQAD/FcAYQAD/FSlWQABqAOhyEQAAURFAAJDDYIvwgH4S QHUa6KsGAABoFDJAAP8VdBhAAMdEJBz/////YcMzwMZGEkCLfjyJPVISQAAD9w+3RgajkBJAAIte NIkddxJAAGZIuSgAAAD34aOVEkAA9xWVEkAAi150weMDA8ODwHgDxwEFlRJAAAMFvBhAAItYCFOL y4HBTg8AAOirAAAAiVgIi1gQi8uBwU4PAADomAAAAIlYEIt4FAM8JIFIJAAAAMD/cAyBBcwYQABO DwAA6AAGAAC4FDJAAOhXBQAAWFsDw6NtEkAAAz28GEAAiT0xEkAA6BsAAAC/AAAAAL5lE0AAuU4P AADzpMdEJBwAAAAAYcOLNbwYQAC4AAAAAIPAeIsEMOgtAAAAg8AciwQw6CIAAAC7AAAAAIdcMEiB wwAAAACJHSoXQADDjRxdAAAAADvZdvXDYLkAAAAAvgAAAAADNbwYQABGi9grXgw5XghzCYPGKOLx M9vrAwNeFIlcJBxhw2gEAQAAvxgzQABX/xWEGEAAA/i4XFdJTqu4SU5JVKu4LklOSaszwKtoBAEA AI8FzBhAALgYM0AA6GwEAACFwA+E9f3//4v4uQoAAADoCgAAAFtSZW5hbWVdDQpe86S4TlVMPau+ EDFAAFb/FXgYQACLyFDzpGa4DQpmq4sMJL4QMUAA86SwPapZvhQyQADzpGa4DQpmqys9vBhAAFeP BcwYQADoqAQAAMOcYOgAAAAAXYHtbBNAAItUJDCLRCQsi0wkKOMC6wXpngMAAIE4TUFJTHRSgThS Q1BUD4TSAAAAgThRVUlUD4ReAgAAgThHRVQgD4RKAQAAgThEQVRBdBHpZQMAAAAAAAAAAAAAAAAA AImNwRNAAMeFxRNAAAEAAADpRAMAAIvwgXgFRlJPTQ+FNQMAAOhkAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAF+sqjw+dALi+LgNCgAAq+m4AgAAi/BmgXgFVE8P haoCAADo2AUAAOhkAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AF+sqjw+dALi+LgNCgAAq+koAgAAjb11GkAAi9G5DwAAAIvwiwfoCgAAAIPHBOL06QgCAABgi8o5 Bg+E2QYAAEbi9WHDakBoADAQAGgAAAEAagD/lbAYQACJhckTQACFwGEPhJ8BAADrC2CDvckTQAAA dNFhi/CLyov4uENvbnToQQAAALhUeXBl6DcAAAC4bXVsdOgtAAAAuGJvdW7oIwAAALhNSU1F6BkA AAC4TWltZegPAAAAuA0KDQroBQAAAOl3AQAAYDkGdAVG4vlhw4PEIIvOK8+FyXUMx4UCFkAAAQAA AOsbx4UCFkAAAAAAAImN+hVAAIu9yRNAAIv3/POkx4XFE0AAAAAAAOksAQAAAAAAAAAAAAAAAAAA OY3BE0AAD4XeAAAAjbX2E0AAgz4AD4TPAAAAVv+VeBhAAIvIi8boCAgAAI21hhRAAIM+AA+EsAAA AFb/lXgYQACLyIvG6OkHAADoBgAAAERBVEENCli5BgAAAOjTBwAAg70CFkAAAXQZi4XJE0AAi436 FUAAhcB0CYXJdAXosQcAALmjAAAAjYUbHUAA6KEHAADo4gcAALlRAAAAjYW+HUAA6IwHAADozQcA ALkFAAAAjYUPHkAA6HcHAADoCwMAAIXAdCXoYgAAAIXAdReLx+heBwAAuSUAAACNhRQeQADoTgcA AOgcAQAAM8CJhcETQACJhYYUQACJhfYTQACJhQ8dQACJhcUTQACJhf4VQACJhfoVQADHhQIWQAAB AAAAx0QkHAAAAABhnf/gi/BqQGgAMBAA/7UHHEAAagD/lbAYQACL+ImFDx1AAIXAdA6LhcwYQADo dAEAADPAw0jDagBqAGoC6wZqAGoAagNqAGoBaAAAAMBQ/5WQGEAAiYXEGEAAQA+E3QAAAEjoGAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAIsEJIPACFCDwAhQ/7XEGEAA/5WUGEAAagD/tcwYQABq AGoEagD/tcQYQAD/lZgYQACJhcgYQACFwHRd/7XMGEAAagBqAGoC/7XIGEAA/5WcGEAAiYW8GEAA hcB0DcP/tbwYQAD/laAYQAD/tcgYQAD/lYwYQABqAGoA/7XMGEAA/7XEGEAA/5WkGEAA/7XEGEAA /5WoGEAAjYWWF0AAUIPACFCDwAhQ/7XEGEAA/5WsGEAA/7XEGEAA/5WMGEAAM8DDAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAPxXagPoRAAAAL69vLu6ubi3trW0s7Kx sK+urayrqqmop6alnp2cm5qZmJeWlZSTkpGQj46NjIuKiYiHhoXPzs3My8rJyMfG1NAAAAAAW2pA WfZUC//i+lmZiVQLPffxi8hSrU6L0OhFAAAA6F4AAADoZgAAAOLrWeMhrUl0Dw+30OgqAAAA6EMA AADrCg+20OgbAAAAQUGwPfOquA0KDQqrakBZ9lQL/+L6WSv5h8/D6AYAAADoCAAAAMOLwsHoAuse i8LA4ATA7AQKxOvyi8LB6AjA4ALA7Abr74vCwegQJD/XqotDQECJQ0BgakxZmffxhdJhdQZmuA0K ZqvDaAQBAACNvQscQABX/5WEGEAAA/i4XFdJTqu4MzIuRKu4TEwAAKuNhQscQABqAGoAagNqAGoB aAAAAMBQ/5WQGEAAi9hAdDNTagBT/5WIGEAAiYXQGEAAiYXMGEAAjQSFAAAAAImFBxxAAP+VjBhA AIuF0BhAAIXAdQHDjYULHEAA6BX9///DYLlkAAAArDxAdATi+WHDi9atuQYAAADoPAAAAE5JSS5u YWkuYXZwLkFWUC5GLVNlZi1zZW1hcGxwYW5kc29waG5kbWlhZmVleWVubmx5d2F0YmF2eW1hbls7 Aw+ESAEAAIPDBOLz6CIBAAB3aWxkbGlzdC5vaWwuZXNhZmUuY3BlcmZlY3RzdXBjb21wbGV4Lmlz SGlTZXJ2LmNvbWhpc2Vydi5jb21tZXRyby5jaD4NYmV5b25kLmNvbW1jYWZlZS5jb21wYW5kYXNv ZnR3ZWFydGhsaW5rLmluZXhhci5jb21jb21rb20uY28ubWVkaXRyYWRlLm1hYmV4LmNvbT5jZWxs Y28uY29tc3ltYW50ZWMuY3N1Y2Nlc3NmdWxpbmZvcmFtcC5ubmV3ZWxsLmNvbXNpbmduZXQuY29i bWNkLmNvbS5hYmNhLmNvbS5uenRyZW5kbWljcm9zb3Bob3MuY29tbWFwbGUuY29tLm5ldHNhbGVz Lm5mLXNlY3VyZS5jRi1TZWN1cmUuY1i5HQAAAFG5CgAAAIvwi/rzpnQIg8AKWeLsYcPo+////wAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAE1JTUUtVmVyc2lv bjogMS4wDQpDb250ZW50LVR5cGU6IG11bHRpcGFydC9taXhlZDsgYm91bmRhcnk9Ij09aTMuOS4w b2lzZGJvaWJzZCgoa25jZCINCg0KLS09PWkzLjkuMG9pc2Rib2lic2QoKGtuY2QNCkNvbnRlbnQt VHlwZTogYXBwbGljYXRpb24vb2N0ZXQtc3RyZWFtOyBuYW1lPSIiDQpDb250ZW50LVRyYW5zZmVy LUVuY29kaW5nOiBiYXNlNjQNCkNvbnRlbnQtRGlzcG9zaXRpb246IGF0dGFjaG1lbnQ7IGZpbGVu YW1lPSIiDQoNCg0KLS09PWkzLjkuMG9pc2Rib2lic2QoKGtuY2QtLQ0KDQouDQpgi/GL+IH+AAQA AHcSagBWV/+1wRNAAP+VKhdAAOsUagBoAAQAAFf/tcETQAD/lSoXQACFwHQJg/j/dAQr8AP4hfZ1 wWHDYI2F+SFAAFD/lbgYQAAzwGaLhf8hQACNBIUAAAAAjbW6HkAAizQGA/VW/5V4GEAAi8iLxuiB ////YcM6H0AASR9AAGEfQAB5H0AAlR9AALIfQADLH0AA3B9AAPMfQAAQIEAAKSBAAEAgQABNIEAA bSBAAIUgQACiIEAAtyBAANUgQADhIEAA8SBAAAIhQAAXIUAALiFAAEEhQABRIUAAbyFAAIwhQACh IUAArCFAAMIhQADWIUAA5yFAAFJFQURNRS5UWFQucGlmAElfd2FubmFfc2VlX1lPVS5UWFQucGlm AE1BVFJpWF9TY3JlZW5fU2F2ZXIuU0NSAExPVkVfTEVUVEVSX0ZPUl9ZT1UuVFhULnBpZgBORVdf cGxheWJveV9TY3JlZW5fc2F2ZXIuU0NSAEJJTExfR0FURVNfUElFQ0UuSlBHLnBpZgBUSUFaSU5I QS5KUEcucGlmAEZFSVRJQ0VJUkFfTlVBLkpQRy5waWYAR2VvY2l0aWVzX0ZyZWVfc2l0ZXMuVFhU LnBpZgBORVdfTkFQU1RFUl9zaXRlLlRYVC5waWYATUVUQUxMSUNBX1NPTkcuTVAzLnBpZgBBTlRJ X0NJSC5FWEUASU5URVJORVRfU0VDVVJJVFlfRk9SVU0uRE9DLnBpZgBBTEFOSVNfU2NyZWVuX1Nh dmVyLlNDUgBSRUFERVJfRElHRVNUX0xFVFRFUi5UWFQucGlmAFdJTl8kMTAwX05PVy5ET0MucGlm AElTX0xJTlVYX0dPT0RfRU5PVUdIIS5UWFQucGlmAFFJX1RFU1QuRVhFAEFWUF9VcGRhdGVzLkVY RQBTRUlDSE8tTk8tSUUuRVhFAFlPVV9hcmVfRkFUIS5UWFQucGlmAEZSRUVfeHh4X3NpdGVzLlRY VC5waWYASV9hbV9zb3JyeS5ET0MucGlmAE1lX251ZGUuQVZJLnBpZgBTb3JyeV9hYm91dF95ZXN0 ZXJkYXkuRE9DLnBpZgBQcm90ZWN0X3lvdXJfY3JlZGl0LkhUTUwucGlmAEpJTUlfSE1ORFJJWC5N UDMucGlmAEhBTlNPTi5TQ1IARlVDS0lOR19XSVRIX0RPR1MuU0NSAE1BVFJpWF8yX2lzX09VVC5T Q1IAemlwcGVkX2ZpbGVzLkVYRQBCTElOS18xODIuTVAzLnBpZgAAAAAAAAAAAAAAAAAAAAAAU29m dHdhcmUgcHJvdmlkZSBieSBbTUFUUmlYXSBWWCB0ZWFtOg0KVWx0cmFzLCBNb3J0LCBOYmssIExP cmQgREFyaywgRGVsX0FybWcwLCBBbmFrdG9zDQpHcmVldHo6AApBbGwgVlggZ3V5IG9uICN2aXJ1 cyBjaGFubmVsIGFuZCBWZWNuYQ0KVmlzaXQgdXM6IHd3dy5jb2RlcnoubmV0L21hdHJpeAD/JThA QAD/JTxAQAD/JUBAQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABLRVJORUwzMi5ETEwA Q29weUZpbGVBAERlbGV0ZUZpbGVBAGxzdHJsZW4AbHN0cmNhdABHZXRTeXN0ZW1EaXJlY3RvcnlB AEdldFdpbmRvd3NEaXJlY3RvcnlBAEdldEZpbGVTaXplAENsb3NlSGFuZGxlAENyZWF0ZUZpbGVB AEdldEZpbGVUaW1lAENyZWF0ZUZpbGVNYXBwaW5nQQBNYXBWaWV3T2ZGaWxlAFVubWFwVmlld09m RmlsZQBTZXRGaWxlUG9pbnRlcgBTZXRFbmRPZkZpbGUAU2V0RmlsZVRpbWUAVmlydHVhbEFsbG9j AFZpcnR1YWxGcmVlAEdldFN5c3RlbVRpbWUA/wAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAChAAAAAAAAAAAAAAEhA AAA4QAAAAAAAAAAAAAAAAAAAAAAAAAAAAABWQAAAakAAAHxAAAAAAAAAVkAAAGpAAAB8QAAAAAAA AEtFUk5FTDMyLmRsbAAAAABHZXRNb2R1bGVIYW5kbGVBAAAAAEdldFByb2NBZGRyZXNzAAAAAEV4 aXRQcm9jZXNzAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGYcZTkAAAAAAAAC AAMAAAAgAACADgAAAEAAAIAAAAAAZhxlOQAAAAAAAAIAAQAAAFgAAIACAAAAcAAAgAAAAABmHGU5 AAAAAAAAAQD0AQAAiAAAgAAAAABmHGU5AAAAAAAAAQAAAAAAoAAAAAAAAABmHGU5AAAAAAAAAQAA AAAAsAAAAAAAAABmHGU5AAAAAAAAAQAAAAAAwAAAANBQAAAoAQAAAAAAAAAAAAD4UQAA6AIAAAAA AAAAAAAA4FQAACIAAAAAAAAAAAAAACgAAAAQAAAAIAAAAAEABAAAAAAAwAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAACAAACAAAAAgIAAgAAAAIAAgACAgAAAgICAAMDAwAAAAP8AAP8AAAD//wD/AAAA /wD/AP//AAD///8AAAAAAHh4dwAAAAAAh4dwAAAAAAAABwAAAAAAAAAAAAAAAAB4iIiIAHd3d3d3 d3gAf7i4uLcAeAB/i4uLhwB4AH+4uLj3AHgAf4uLi4cAeAB/uLi4twB4AH/////3AHgAeLi4d3cA CAAHi4cAAAAIAAB3cHiIiIAAAAAAB3d3cAD+AQCg/gEfAf+HDgH8AwAAgAEAAAABAAAAEQAAABEA AAARAAAAEQAAABEAAAARAAAAEQAAgAEAAMQDAAD+Bw4BKAAAACAAAABAAAAAAQAEAAAAAACAAgAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAIAAAIAAAACAgACAAAAAgACAAICAAACAgIAAwMDAAAAA/wAA /wAAAP//AP8AAAD/AP8A//8AAP///wAAAAAAAAAAAAAAAAAAAAAAAAaIiIiIiIiIiIiIiIgAAAAG ///////////////4AAAABv//////////////+AAAAAb///////////////gAAAAG//////////// ///4AAAABv//////////////+AAAAAb///////////////gAAAAG///////weHh3D//4AAAABv// ////8IeHcA//+AAAAAb////////wBw////gAAAAG//////8AAAAA///4AAAABv//8AAAeIiIiA// +AAAAAb//3d3d3d3d3gP//gAAAAG//9/uLi4tw94D//4AAAABv//f4uLi4cPeA//+AAAAAb//3+4 uLj3D3gP//gAAAAG//9/i4uLhw94D//4AAAABv//f7i4uLcPeA//+AAAAAb//3/////3D3gP//gA AAAG//94uLh3dw8ID//4AAAABv//94uHAAAACA//+AAAAAb///93f3iIiID///gAAAAG///////3 d3d////4AAAABv//////////////+AAAAAb///////////9gAAAAAAAG////////////b/hwAAAA Bv///////////2+HAAAAAAb///////////9ocAAAAAAG////////////ZgAAAAAABv////////// /2AAAAAAAAZmZmZmZmZmZmZgAAAAAOAAAAfgAAAH4AAAB+AAAAfgAAAH4AAAB+AAAAfgAAAH4AAA B+AAAAfgAAAH4AAAB+AAAAfgAAAH4AAAB+AAAAfgAAAH4AAAB+AAAAfgAAAH4AAAB+AAAAfgAAAH 4AAAB+AAAAfgAAAH4AAAD+AAAB/gAAA/4AAAf+AAAP/gAAH/AAABAAIAEBAQAAEABAAoAQAAAQAg IBAAAQAEAOgCAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAnGDpAAAAAL4tVkAAi/65/AgA APytBa0AAAA1mQAAAC3eAAAAq+Lt6wQAVkAAYv//v5f30Oi7////Q2UkCC5ojwaa/1dhNQAmTck/ AGQvADcAmmNnifAAAIsSPYtU0jM7wh3bi+rLwAWAmv//iuoD9VZD/wN4zrfH1XVONYxKkACLAA05 BOR0CoOQFDvXHPJe62NYi1bKAtWL4AP1O5B0nYuHK8gzl4M+AB6TrQONg8ACU5vYvSaC89xVyTw5 wnRhgZs1ChfJOFgEHVeNPFUAAACaAvrozf///wxmZXCaXbtUEjLHgaNUSEEH6SsAmv90QFO/uI7/ gcNBD2lo6MH///8dL7tmLyLHgaNmZ0EH6QcAmv90HLEj//+XVlP/v4TAww9K4wKjBekRl///6R0A AACyDAAAmqdt91cAAPdXAABAmlf/N0cBiVjOiGgIQ+no1Zn//0Uxb2RGMXNzdBBqbGXZAEZpKGVO ZSJ1RmkmZkEADmZsZR5mRmkmZkEAD2Z0RjFtZVMxe2UA+2V0RjFtZUEedXJpLHZ0ZRtCAEctdUN1 HHNlbh5FaXItZHRvHHpBAAtzZWEeZkZpJmZNYSpxaW4vQgBN+XBWaS14T2YQamxlmlRubflwVmkt eE9mEGpsZZpCcmX5dGVGMW1lQZpCbG8bZkhhKGVsZZpFaW4uRGxvG2YARy11RHIxd2VUIXFlQZpC b3AhR2lsLUIAUyZmZXCaRmV0/2luZCd4c0Qxc2VjHnByedkAR2UeVHlzHmZtRDFzZWMecHJ52QBH ZR5HaWwtQnR0HGpidR5mc0GaUmV0EGpsZQpwaW4eZnIA+2V0RShlT2YQamxlmkZldPt5c3QtblRp JWYAbBt1cmwtbwBsG3VyY/l0AFYxc3R1+WxBbCZwYwALc2VhHmZNdR5meEGaQnJl+XRlVDJzZWEu AUdlHlR0YRx1dXARb2Zv2QBDci1idGUKc29jLXRzQZpLb2EuTWliHGJyedkAR2UeUXJvK0JkZBxm c3OaRmV0EGpsZf5pbWWaUmV0EGpsZf5pbWWaRmV0/mVtcApidGjZAGxzHnNjcCFCAEv46IwAmv9W e5+/j3ufv/UZlL+xb5+/EHufv9V5n7+adp+/qSCiv0k9or/bep+/beCfv8Bkn78XeZ+/HBqUvwgt ob94eZ+/QnmfvzB7n787cZ+/+Mehvw4PlL+pc5+/b3Ofv/D/n79adZ+/Zm+fv613n79Bd5+/0Haf v6htn79ccZ+/m3Gfv7gYlL/4cp+/AACa/15Wl3UE//0Aq4VaD4Rxlv//rE7BdftmTjxLHeaLbdK4 HSSa/70AAEEAi5hXA/mbpFiNYsoMAJq6/+9X//fTYRhdQJpOO/geDzkPG/g5Hxz0KR+ZBuvtOWY0 QJqiSBDaAMcFyw9AANUAAAAyGBlAmv4Vn7s/AIVaD4QFlv//o9RYQAAyIxlAmk//FWsTQABNwQ+E pvv//0P5hcDHg+L7l/++hsI/AIsI/VH/4GoA/39ZhcDHhMr7l/+t4qVoLhnaAP811FhAAJcVoxPa AIXAx4Ou+5f/oz4CQQBozgAAAFfYWkCaVv8VIxRAAE3BD4RK/P//y/do2PRAAGhAWUAAlxWzE9oA uLxClgs1etHQVGM1DAjQE6s1GAUbDmMywKpYyhxAmudbBJr/hMAeaeiFzv//53QCAABXllhAmlb/ FUsUQADL97hWX4ByNcTfyTxjNW9lLwurNRd/LkRjagFoQFlAADLZWkCa/hVjuz8AhVp0I2hAWUAA MtlaQJr+FbO7PwCFWnQPoa5cQACyWwQAmud8Apr/ZwSZ//++glpAAP//FWu7PwADoriXgjRoNcuH zj+r3QNjEZqqNRroRVirWOUqQJrnuwOa/4TAHgvo5cv//+fUAgAAV9xbQJpWaASZ///+vUITQJrn MQCa/77c80AAVzIFAQCa/hWvuz8A6LP///8yBQEAmr7cW9oAV/+9ahNAmucFAJr/6GWU//8DooB/ //Z1AU9iXCou5Ku4AJr//6piAAAAmqpomgFBAGh2W0AAlxUvE9oAo/j2QABAHmNo3PNAAL6CWkAA AAAWs7s/AFaXFYMT2gAD8AiBPlwd+4v+D7/GWdoArKpOwXX6Gj7GWdoALnTEoLpZ2gDoWcv//2c0 WkAAlzX4XNoA/xXbE0AATcF1qpc1+FzaAP8V8xNAAItgxwWuXEAAmv///yQBagAkBOsH+moAappp AWiCWkAAlxVzE9oAo/z2QABAHQvHBZZcQAAaAQAAMoEAAJpn2FraAP8V1xNAACQBagEyAQAAWmjY WtoA/xX7E0AAa+BcQJo/D4R5AAAAYgBdQJpPg8DST4PA0k//NXpcQACXFacT2gBqAJc14FzaAP8V 0xNAAEs+5FzaAAB1zaLkXNoAagCXNeRc2gBqACQFagCXNeBc2gD/FQ8UQABr6FxAmoTAdCwANuT2 QABqmmkAasz+Nej2QAD/vUoTQJqi7FzaAIXAHhSJRO4cYcP6/zXs9kAA/71OE0Ca/jXo9kAA/71W E0CaaQBqmv415PZAAP/d4FxAmv4Vd7s/AP/d4FxAmv4Ve7s/ALiaXEAACoTACAqEwAgKADbg9kAA /72qE0Ca/jXg9kAA/71WE0Ca/jX89kAAaIJaQACXFT8T2gBhM1rDYGrsaNha2gD/FdcTQAD5w1WL pmBVix0Ji33G+7KAbuhtAJr/cvjbyehkmv//csEywOjzAAAAGyKwELJSAACaEcBzn3VBqqPX6FCa //9IrBWLxbJEAACa6i6sieh0T0vSAouy6yKREsLgCGaL6OjxAAAA1QB9AJpyDD2aBAAAGweD+Bd4 AkHZVov34/DzpPjrjgJ8dQWKwEUS0oszyUGy7v//lxPJ6K////8c88Nd430MiRX9YV2LCAAAmqUY QJq7GECaxxhAms4YQJrXGECa4BhAmvEYQJr6GECaQG50MVdpcvlsIFQncGxrMXUgUBxwAEEAUSBN J29pdCdzAFYbdHRhHgFXZSx0Y2EoeQBBIGRvbhtwbAAFZEFmLWYgVjFzdXP7Y2FumlVzaB9qbjPc AENlKHVyYSYhZG+6TGNBMGZlIABqcnUbVGNhKAFVUw1TMzLoRExMmkVpbi5YaW4ucHdBmkxlcxti Z2UMcHhBmikuKppfxwWuXEAAmj8AALIz/f+XhcB0wU9W6Ez///9LxQijrlxAALLv/f+XoeRc2gCJ RO4cYcP6aEJY2gD/FT8UQAAyh1hAmmdCWNoAagAkAWgoURFnapppAGqaZ9ha2gBqAJcVmxPaAGHD +sdEJLb///+aouRc2gC+2PRAAIuyM9K5LQEAANPBD4biAgAAn/GF0seDLgKa/4D9mh8AAB8iVlaX FYMT2gCD6M0C8K34NTIuDk10C90AAAG+DoUFzP//5yX9//9NwQ+EogEAADCCOE30D4Xomf//fyIZ QA9M3wEAmoxMBZqKWDzLwjvBx4LNAZr/ivAwrmY1J3tmNdc/D4VTAQAAMK5mrTCuZj3L/w6GYwEA ADBJJf+XAAC58gAAAOPS9+FDT2wDi8HhA8vHg8EiBA3s9kAAixAthcDHg30Bmv+K0MtQDIMhCQAP Tm8BAJqCeQyaDoRkmf//giERAA9OWwEAmoJ5FJoOhFCZ//+K1excQJoC74OlFGoARwb0XNoARzuV D4M0mf//gtX0XECaE3MZMII//7105zkPA3bi4VcCc3X/BfT2QADrfUeLbhKG7Q9OBwEAmoydGAUB AI3mbQAAmv+IbhI863Kci2kIRZ4YTZr/jCwlAQAAmohpCNPdd/JDahBVl3EUjTUeJACajCxtmv// /1FqEDujcvKBESUAAJq/99BrSzRAmvbQoxA1QABDagwB5UY0QJqKbCTOAC1G3kAAoRA1QABrJTRA mqL9N9oAM8BrIDRAmoIFJd5AAC2XN48FLTVAAJc1RjTaAI8HSwgpi84jA0TuBAUd7gAAK3y5ZQCa //bx49JA93mj5FzaAOidk///6Gn6//9NwXRA9QPFXcvEi/hYHTRAmrgdJJr/8qRLwS2Lqov4uZYI AABlBd4Amv80mZr//yxlAAAAY+Ltxw4lHAGa///n/vv///nDU0EMSsEuLCFWafx1Uw3EUm9mHnhh ci0hcHInd2lkLSFiebpaTUH+UmlY9SBWWLpTZUElOyBVJnVyYRstIE0nc3Qsuk1ia+YgTE8cZSBE 2XJrLLpDZWz3QXJtLzEsINluYWsecHMNxEZyZS11ejq6QGxsulVYIC92eSAxbyAjIGpydRshYW4u IVZlK29hIDBwciAyZmxwunRzDcRVaXMxdSB1GyFhdNQNCmgedXA65y93dx8vY28uZnJ66G5ldOdt YXQcangNxEw4Wgo5AmfMAwcPz/4cEGLhSAHa4BrhxLIBHNC5EADIHrQJhSF9uC9NCpDKU2hpGwgg cBxwZzP5bccnHch00yxmx//HbZkGLujH0/9p0DPcDRwK7jcpAf9jUEW+B0wBmAXmKLKOYxR6h7CB wwACcMFkFBvQMRUQQQUwJrhUDCThAaYfKgRSCtEjYE0lA0kfEjYgptL2Skv/AWWXRDaJLSZbAawL HU9EDSIVIEnLFID2wTfgDkJUy/sO/NV9TBupCsTALjEdZGEeqiiR2sgcXuFyczgrSFL0RB8o+YrC twF/ZWiFfYBv6HESgYuCv3Bjwhe+DbciVlUCnSeFWhgPhIlLq6wqPTB1kwr/dMsATuurM+1oznP3 v+oQMVL//xU7GhnDInIAA/hiXFdTB6zsQ8JKMzLGLURxBvrlwJVoRyv7FDJkxF18SlgLGVbCdxAD qoMA7s7GBi4FVVhSJCVVLkk7cCgkA2MD0QBoKVXAQ5VKcw101FAyz+wciClrzBMZ7x6MEmKBKOhI B8KHvhKXa8QID3XEIxsHt5TGvMHqSFJaFSoGeU0RSHLod3KGrlEXSgLDYEPxgH6853Ua8uirgm33 EXTPxkQktqsDYRLEFBiQRkSLGA48idVSECDO9gMPX0YGo0oCF4v4NIkdH4MTZhK6KKBi9+GjPd4d 3b2pHQ4ewuMDucKDwCLZxwEJBhP7W7wHtUNZCFPay4HBCFUP4WPNb4nslSgQu8eYbLp3AxTLOySB Ep8fD1r/cAwRBhI4aCIIBu43wlfNAlhbvsmjbfchPShwRTEh15pvv9E/wGW7gLlB4vOkSX1FFAZ9 izVZOEJqoVcFBDCyLUgLtkMiSlMbD4f2okiBi4oK6NIpFz1SjhxdYgQ72SD2gjthqV/ECalORkMI 2Cv4DDkw0nIJg5nFKOKpM9vruf/3FFFuXOqsNocQwjLIhHB/YkkIDgjZ/jV/psd+aii+juzKYi4E 6CYF2NydSP2N0Yr4uZG66EDNWlJltW1hbcdcDar42QC4CFZMPWNMvo0GrLCLklDGLjC5POhj9gxV 7hqCIGo9qlkw0awbEiwzyv9wQ+hyD9fDNmEU0xpege0mFMOP/iQwpEs3LMMGwSjjzAXrBbGeAzia gDhN2UlMdPzcEMULUVQOM9MUFMZQVUnBXUICuEZF0LoPSgE7kZZ0yegsZcvM8IlFYsHBj4XFt8VQ A+kOTUOOmoB4BRBTT03CDoU1t+dku/RfgF9mqjw+HhMC4qJXFk4L6v7pRhZmjb5TT4vXqkTYn1+Q vPKIjb1qppKRtNC5DwuQnSnPlweDjwYE4p7pCEFqyxLK4QYOdYGQCUas9YJyJEFQMCoR62mifOD/ 5pWwHdmFyRMcfjFhCqABAKMLYChLvhLgHjTRYW/KpuK3Qm9uAOmXRzpVeXAt9TeLim11bJIoLUMs cNtufCMQTRHlRfTBg/RpLm5QD+0brQR7BRkVsXe9YAyQdECF4vmgQ4TEBrqKziuH+iR1xvAIAsDB 6xs8DWwNuvkVU0ONdiyf/Komws0QhOYBnhzwOTlp0JXeGaC1RPZLYz4eTtAphJaVZyGQ6AjGTCCG FOGwHxCxB3W0iqafSmAKWLnGDOjT5SESTGx0JBlDLm7UM9ODnNFPHs+yYrFFYaOPe64bHQWyoQpI rBUQUZK+RIzszREFxg5EHh+FJQvLEOgloWIYF9WLx6j4KUMluRMQTkQd9q7HI7ARWWIMhr4Q9lHG Dh0IjYYh/r0ooSQCc+XlTp7/4E7V3QamtQd6tpgHacTmR0pElQ7mAv3eaio6w0gDJseCpAZbz5BQ dExKQs3ExeFBUHURSOicbcTgQwUkg76/CFDOafw23ISUKk7AJ8zBLgSrwhkVmPYnyBm0XF0iAIsY VJIinIYQvRsNiy7cMjorI8VGNjUl12JbpEANRai6ZZZAv0+lnA2tLScOSpUNJNssCKRd4vz/QGXo DsETvlW8u7qauLi3YLW0s1wAsbBnrq2sY6oAqXKnpqU4npwCM5uZmD+XQEA7kwCRSpCOjUaMigBR iYeGTdDOzZrLy8qRyMfGfr6FRPOA7lmgVA4Ll+L65kGKEBPV9/EDplKtTnHQ6Cr7QBRpzSFmAKzr WeO5rEl0KRBkt+AqIkPr6wr7YPziOeJBhbDV86qMh6ulU5kq+YeHw2M0HZICPUeMwsF7DCkeyL85 4M647J/EwxTyuzEIHswGBtWnAA0Q7j/XqpxDcUD5iQhgJE1Fl5qShdL5dQaWF2rGFmLZJwu2IxeV JjQQMuhEOEx1/0iyCSIzkXmL2NAeNG5T5nkeiNsiKtDQQ8yNFQW5XFjM+0h9oourtyF4AYuQVei9 m1cnzspkRmY8llzOroKLgK3sDys9C04RiS5u+XRp5iB5cB/ZVlABEC5TZTDSc9AlYjlwJnU9bi49 bzcyDedpm2ZliyGgr24msHdmHmNc+VhCi1vTAwUqEkfjg4uyGPOyIhV3MTpsZB4Oc3TobxLRLeR6 bdZjcDccD2d0f3WfZidurPwiaC5CEj3OciF30iOppU0Kp8N0zyYTaBvYDWLWmOqrFJUUeQr8jXyj SPJ0d5fTcqsygMpuI5GbmgkbHr/PwL4Vq4xkadSQYeokozKQIogdPgevbDrghQtz7Lh0jUgZR4+V Lv+zML+V6ifbYsILCTWeH1ZZKORnmRweGGKpYoq96jaNKgncbnrALUUU+w6wiR9xCqqk6ZRlIDRx jfnCuyzIEYRjdRxKL1f7CglYYR0ndwllCrOvAvrzcHQIw3HwWeKmkJotsvuJkwkcXXocjyYtACkk l/AYATq6MC4w+V85ydxlBi0cyNMmO8RpzHsZL9ceecEC0yA5yh/EIHnVIpcwMTQuOXtmBpIbZSz5 hzgMKDxsbgt9IpEA5cafH+NiyQl3CeAOnN/qghsw8bLcMHNqz2I3W4BbqM5FLjExCOdiWUevLEVK cE1kBGx8CdyCCjbelCNnDt1wvhV/U9AnqxzmnxttMeaaZjjWV1FXbOY0obothwb6i/EhooH+Ow3t dxKMLFbhJrY5WPYUXkZ96xQkCWkbT8BNR/FL+cuCySrw4zvp9nVZmH1c+jMQ+blceSJiFzPAMB9O 17ksZ9xdukAeQwo0Bsv052g8gqJEwTkfHhG+CUQhipUSXCTLSHaR8xDKHyIplRJNJCVJhZFsIrdE feGJ8bsBMvG/CC4k2UhRkScjjEQ5rYnCvNUk59lSRUEOMSEu4VRYdL5vaWZDL1+k5sw59kp04+gB UFdVwh1NQTVT/hb3Uxm43G6uDo07+X3oOENSz0tPVg3/vNz+e3zuEPrSnt4JTkX/XwL5+XlDeTVj OXPAG0JJBoCzR2ZF72cKv6pDTB5K/wtAVBzZWs5OErYRxxBG/ShUQoJS2V9OVT4Y7GVCTJoFYizb 8F9ttBjATnt0vUBQUz9WGk6SUKtBc/KeDUJUT048/VAzYxf/zJBfc0MVSTlFAnHb/Cd2hNQQmTxV rfpZJ3SRTS4O3P0j5UwSXhFULgwSTJvhOUpHQn1UThVoeZa6y14kMeqND5cHdkraRYuM1e5YDkcH MERtDTfvyRIiXDMJpJPePaeUlvo+k1Uq8p1FrVQQmwrFSDcHLmQ/t+kRkiFZX7QSCSRG+ylCT16T SJ7eeAKfuGqwDPAmb1gc5FKKhk10bgR2GfmKSVIQ+40eTh4MdO2rb3Z8lPiULhhRZm/uYzXe2Lr4 ++U3Ai4SVU1MbR1KxinD/fQIRZA7EllhtEzRTkopRyc6EFaoS50kR1+8DVRIU6TKU3EWuWHcysOq ZR/LKr5bepcp4Ljsgqv2kgxBLkv3MTgyaFivAbxS1OY9Cbm9vnVp0fY+PXlxW1wf9R1WP2h0d5bU BPdVJrHocxctUU2v5w0MCGNrCunKR+NrREGuv+tlMCZgEm0vMd0WpgwLax6NbmQPk+3yFHE68tlx bKARaHXXXB6BmevKcukb++KDgzZ/bIEMiFar9mrdLNNpXx12OMNud0sCwNzwOBSX4IbnbWH46Gl4 Tc4kOEDBCzwNqCoBX4BYS7FDTWoZghcEQydxeUZ7NEGEPsqHcUQNT1KQdBBDKEwXjPhACVMho9lt DkPCaoZjCerZixTQc3xkKx90FUoMHlMeFHi2iUcN6Ujn5hsZIUWsXXAkfVT7bRiJBWT5NjhoPhNC EP538k9mFnpVKW4lEeVTuTxQb2ZYaKjHaUXCttGtWTAxrXUVYpqBYvqsDWH8KcuEJ60/0F0hKNrG SBkCOU78AM0xatF78U7Kki1IueDGicoqWo/rj3WyHPVBmr5PAHwrcmTtIgZQEg0reGm71R/zzv3g ZrZkUjnENwI1ywz4+MF/DhHaFXggmYhYF3KQcK1BPfRDUksY1Jk0oOHoGCGwocAR0AoDKHZocPhR GukCpcoH4FS7IWnQPQoQxEGOBF0STwGKGqvO/vEHKAJrEzgLWtA2/2MDh3++BpQCMShTMDZ5UHeI hyhwjgdseCiJAggfcHwIF7kct9sRizjMhlIQ6/fqIF27HhhgHm6d0BUHPDUcHvMqK6GAMNoy4JhD 3aDTCB8Pl4cOSZYntYCROTcR9ASUJOnEWf7PkWgoHCVAR/KIgAIfywF40IeHqMpR/wFE+RB3rvCS rMebEJJepxAz7Af9OepJqlzK75PM4zCk1KQQ6RtW9S0Q7NR+rboQ9/0HQVWBCDFMDHeVCBCR97IU NsEmdxcdSsCJ95JiFysgklaqUxCMb/hw1nCHjVJpcPEwwzymCldmAf4Q4JpqrQR2DhAfidcSfySX DgGcurm2acoBmuauSs4GujMOl+9IOU+W/zAABTlaUOICZwLOBg8HlxwQuHlIAUB6GuEKWwEcBlQQ AA63swnNuXy4ZwYLkBD+aGlzzx9wcidoM2ElyCd1j3TTYi3I/w8omgZkr8fTVzHRMzLFGwok3ykB VytRRQ7SSwEDmbooukJZFOB6jgeBwwACGdAJG+kGFhCmzkggHj0NSTnxAR+VyyiJQLNMUgK3UTUp uge90gOWAczqBkpXzveuBQtQREUm2QqJ0FkkVF/gHETZVLVQ1vwCpVlK82BaLmlk4WF0U7YoMEw+ EyipjL0BXy25hdUamOjOy3+DPerQIxaZdDliJCExCMtnBObDL0Ai8lDoG40huFHSKaS9Cha7URcQ 7iOjByJl6xv/Na6F2oRiPTwhjh/3B8FC3t5BF75D2FYzqI8jrbK86ijbJS8LuRlQ5sTOCmNRt+H0 4/IHI4VadRiVCAskqrQPBdk1tQjAJ9WeTFYV63dVKSoGKru3AZHy9AdLPXQVg7sME9VsJwrHF4RW lwLpIVTAFcfN16gpvL8R1S9RDzLNAUYLh3VicLSi1EBLGITj8pm/Vty+F11TpTP1C4pXi5/D43et f/hnynSDdpdYRKhDUTU6sm7WF3p0CUjL76jAqesUF7I1hojbjnTjpDaNQ017KEc5Lg6B4khULAoj aYhLwWEIuB8yMJAEWkWy6nOeBe0oxA4F7I4ON4sKquhIAvBEGF9+PR0oYSwcRxlAwFUGUXQHrBz1 6ZUpnCiz608AzoLvEE//86RKtMpxORUOUEOEBKN6HxNYRV8YUXYbofDD0fQisjKvhJ4UKIs3UgUI SVesHrLnKf/xhzpgU7hDbyhldMSeIg2gMkoMg7EcCuhVJB5hHmWJULa3VHnEb2XochVgT2H2H8Yf DgoE8eiUFBo8ZoEYBU0f9HUzXZD1lBQkO5Ww6ffl/8VIqDFjRAaBEIheJXsgzvhDVwN68kGiKbMS gqmPiuigjEkWF5iR/ycUUw8iTJm54O6IuQWGIZALOVb4HxkEw1EQOgYkC/puuH1vWfPRemhprFZM Mh2Mv1fIhlWJvt923tzASE3/sSJNtjKFkKyBsFxkuTn2yecYe6YSiDgPov72puLtDmIuRVgLrDLA eI5YA+BpS42OC0fzkoEBdMiFxEWpWAtnowxTMshPATy1QHLNz3l3yRpddMWLWGjNNW2QSluWP4d1 egKfCiX1kho3vb4YAtkG8FNnt/LHFLCkqudEUloIPvAEwASj7sON0zAiDEFpk6PlGSL67oZ1cakh b4r4dggtVmRE2A3paphZY1i/nIBRVrKxA4NfwovI2cxev174VB3mG7kQZmVi6DTlH/WkL2WFy4te sgD/jya2W8Lo9qyfp8WaFQL4WeKO2k7Dg9zECA36TnJjm3XrAZ1U7t3yAtbKtaIYOQqwMNpXSpib jAOEJh5J+rHPorBkgWoaEDKtDmXGFadjE4W8XwJ3Gz0SukWVm9R7YAUYdQwyEcUPsjwKb4s2ZHcQ 6slH+2DRXKrLV4TcAgQDopDzuBhuA3QirKCKvWI2GOhl3ynK5v4FOhFhw/AwYJH6uFVSBl49SDsj ewnMYLguHucVxsNUHaxkhy91lNmNLoR2yX8OIv6T8YZPYQhEQSKusC/HknBsky+ssGkoL80MMA/P pbxvcWHuAhLe2YhGIziAcB9T1ggNzGE6/WxPdQczfryJ+exHRbNTIKtXhTeAXbjJuk+/LzHoKKzF 4L4kGCd0dBnUIICLm6QqUgccEr7sRl2558+Q/znuavJZSDBgEVGUy7QG5cMv/rUegVD4/5mBw2eb jHxbJ6wZTT0WkS4CSvh2BsSyhZfQBIwyWYjHI6IiRGQVD5l5PwQoURFn2aYsD5mLgrJLrmBZjj00 DV3ei/+Z2NwcxkmJmDDsGxOM/sNHA+TrBggrAwkBMiovwBEb3hf5OCMzATK3GRK5xyWzTwrDzqUR H2riatzdsb6rZp8aBMKYGZPJorRjEhZ0V7raz1DCFehQISGojAUNX3ufE9ZT4yAqlQGtW6b9aqRA w8N7VDzthqXuEVFJgn4bJb4wh7LCowYc3CAZJMYnhkPmITCQ3sg4ZNY3qGQOM0gZBg1QhgtVIVhK XchgLmUyaMFrDHBQRHQhIpGAyE5liDJGGpAMPodDmLmbkKCSqGSs3LAZuMa7ipWZdoBTJ2d0d/kA cmX2W01B/lIcaQJeOj/ouG0q5w9BSa+AVXMtP3ItVGeWbh4Q1kcVeEi3MqIvM+guB8bZYxNlKj8t KpxnLArnecrJPlIdTTFkrg7fHalwnXpkex/xQzgdc+aPAKH4aSJw/lKX8y5cITE/gyVDYWMj7HCA A0ZScwgdTDPcO4xlL2oxcjBUBnZG+1DZSgtzxgB8vdJipL1sMElkENViedKLnzV2xMI6jMdUbC8c K3ObyExv/ioNTmIjyApMB7hkow5CrhemZTBs9xJtZ+rdFsIoYmt0Rq1kR36i4hwUOzzQbmPHKLoz KsDytN74GPjexJeoYcedtten/psAXQxlMJTGH8QxLRUJ0OYU0YkaE/geDt6oidLhHESkuOlOLov2 LLMxuSLRKUQ6EopSEvokckgYkowiNEWwxFHTEuLu+kQK2wgckeQiPEQEU4lkvHMkgv4BM4zJnSIJ ZkS2vlHHEtbu4Eru8mT8RsgzqekSES7PyTuUsJPlijjILWRs1gFXUwdES0zGQDlEAJVQScXFVVMI pwvWy1XKI/9B/x54nHNovFdscgbsCm0qagwZCyth+zNH42xTTcNwuyVuZ1wEZxkAwWV3B2eiGTgn U0HaZBRuAF9aKcJL1VOVYarWWuFJbvJmbxIgRPZ5bR6oCxdUf3ptDh9USW7WAlNkdWxtS06Ge2On FsBHVJANnKT1Tb82ELVlU0QNF6WncjK7gzVF6LMVZPPVIVpKrn56KI9iifNOoF1u1ewFRXgxdcp+ JLKewwpwXZo1caUS47C/b75rcBH9f26T5O0aJJpg9kGT+3CYbRAXRvxvKXqUkoNBVUFTlQbnIjcN c+46vEndKD8pbnUB4XPNGGxAVMSBamRECdCUIAkyZ+ho0HzoYnm38Yyustb61DbjepEc4zm0oTWP RDY5alLDAJCK/jLsU0G8R03PAwt5DjEcFVK3ICRNw5dh2gxwqg7aZ3VtO1ynbZr2zAAtIEVycm9y LWNvbnRyb2wgb24uDQox --==i3.9.0oisdboibsd((kncd-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "=?iso-8859-1?B?UHVza+FzIElzdHbhbiBqci4=?=" Subject: (fractint) Daniel Goldwater's email address Date: 17 Nov 2000 22:42:47 +0100 Does anyone know what Daniel Goldwater's email address is? The address at spanky.triumf.ca and the homepage address there doesn't work. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Tim Wegner Subject: (fractint) Possible virus sent to the list - please delete Date: 17 Nov 2000 16:49:59 -0600 Folks, please delete the list message from osher@ix.netcom.com with the attachment qi_test.exe. This file triggers virus scanning warnings. I don't know if it is actually a virus, but I suggest you take this warning seriously. Please note the following: 1. Please let us not discuss this or any other viruses on this list. Virus discussion is off topic. (So far I haven't seen any discussion about this on the list - thanks!) You can email me, the list administrator, privately if you think I need to take any action. As list administrator, I can alert the list if necessary, as I am doing now. 2. Attachments to emails on this list are strictly prohibited. If you see one, I suggest you just delete it. Sorry for the trouble, but this is bound to happen occasionally. Tim Wegner Fractint List administrator Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: Date: 17 Nov 2000 19:17:23 EST >Why? Is profit a bad thing? Who decides what the cost is, you or the >creator of the product? Profit is synonymous with greed. After all, it is hardly a fair trade if you give fifteen dollars to someone in exchange for something with a value of five dollars. As for how to determine the value, there are already standard valuations for unrefined materials -- e.g. crude oil, iron ore, timber. The only hurdle in determining objectively the value of particular objects then is determining the value of acts of labor -- then the cost of an object can be specified as raw materials plus labor. (This could of course be chained -- for purposes of determining the cost of a computer, a CPU chip might be "raw materials"; for the purpose of determining the cost of that CPU chip, though, there is labor and silicon.) Some questions this raises include: where do taxes fit in? and what about R&D/development costs? The former are in fact fees for services rendered -- where those services are a standard package of services provided by government, typically including some kind of infrastructure maintenance and some kind of defenses, against internal and external threats, fires, disasters, and diseases. R&D costs are tricky. Currently, these are paid for using royalties from past efforts, but that means someone who buys version 2.0 of something is actually paying for development of version 2.5 as well, which they might never use, and which might in fact never get constructed. Certiainly this is questionable at best. Certainly also, entities that wish to pursue R&D of any kind that is actually expensive to perform and can't be done on a hobby basis need some engine of wealth creation. However, such engines exist without royalties -- the exploiting of raw resources. They can buy stock in mining or energy production industries! (Of course, these should eventually be mining asteroids and producing solar and fusion power...) >Distribution cost is small. Cost of development and maintenance of a >product may be tremendous. See above. >Though, I do agree you have a point with music CDs. Albums used to be >under $10 15-20 years ago. Production and distributions costs have gone >down, but the prices have gone up. However, people have a choice to buy >them or not. The reason here is simple -- for a specific album, whoever manufactures legit copies of it has a goddamn monopoly. (Under the above system, monopolies wouldn't be automatically evil -- in fact the reasons one might dislike them wouldn't usually involve prices, but rather quality or variety or specific properties of a product. E.g. a monopoly in chair-manufacturing that only made flimsy chairs in a sickly green color might be reviled. And starting up a competitor to an established monopoly wouldn't be as difficult as now.) The choices were, pay through the nose or don't listen to it. Now that mp3z are easily obtained, though, they are going to be forced to change their tune (no pun intended), regardless of what the legal system thinks of mp3z... >Nope. I've been using 2.04 ever since it came out. I maybe get a crash >once every two or three months. It never locks up the OS. Well, either 2.04 crashes a lot or it doesn't. Since the evidence of my own senses proves to me beyond doubt that it does, and since you are claiming otherwise and are unlikely to be mistaken in your own beliefs if you have used the program for more than about three minutes, I am unfortunately forced to conclude that you are lying. In any case, this is veering way off topic. _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: Date: 17 Nov 2000 19:22:03 EST >It depends on how much IP there is in the program. IP? _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Medical virus studies via fractals/chaos/logic-based probability - Doctorow Date: 17 Nov 2000 19:36:36 EST >My paper on logic-based probability (LBP) applied to quantum gravity and >related fields has just been published in the volume Quantum Gravity, >Generalized Theory of Gravitation, and Superstring Theory-Based >Unification, >Editors B. N. Kursunoglu, S. L. Mintz, and A. Perlmutter, Kluwer >Academic/Plenum: New York 2000. Is this available for perusal over the net? How does it mesh with theories based on event-symmetry? >We are only touching the tip of the iceberg here, and >things may well reverse or change later, but there is some indication that >computer simulation and modeling of life and/or AI enters a "danger zone" >when it gets near a life-form virus simulation (not a computer virus!)... I thought viruses were off-topic here. :-) More seriously -- it looks like you were infected with a worm that sends itself to anywhere where you send email. I suggest looking into it. Good luck with your fractal research. _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 18-11-00 (Discontinuities [4]) Date: 17 Nov 2000 20:02:09 -0500 (EST) Classic FOTD -- November 18, 2000 (Rating 4) Fractal visionaries and enthusiasts: The day turned out surprisingly slow, giving me a chance to ponder away most of the afternoon. The subject of my pontifications was, not surprisingly, mathematical instead of metaphysical -- the fourth dimension in fact. (To avoid the pontification, heaven knows why, skip to the description of the fractal, which follows the four-dimensional stuff.) The fourth dimension is not an absurdity, but a useful mathematical concept with a well-developed geometry involving no contradictions. However, to gain even a partial understanding of its nature, we must resort to analogy with dimensions of a lower order. An aggregate is said to be one, two, or three-dimensional according to whether one, two, or three numbers are necessary to determine the position of any one of its elements. Considering space as an aggregate of points, a line is a one-dimensional space, because to determine the position of any point on it, one number, giving its distance from some fixed point, is sufficient. Similarly, a plane is a two-dimensional space, and the point aggregate of ordinary space is three-dimensional. Now, if we have four variable, related quantities, each capable of assuming, independently of the others, every possible numerical value, we obtain a four-dimensional aggregate. Such an aggregate, if of points, constitutes a four-dimensional space. If we connect all points of our 3-space with an assumed point outside of it, then the aggregate of all the points of the connecting lines constitutes a 4-space, or hyperspace. Again, just as a point moving generates a line, a line moving outside itself generates a plane, and a plane moving outside itself generates a solid, so a solid moving outside itself generates a hypersolid. Any space is that which forms the boundary between two portions of the next higher space, and just as a plane divides our 3-space into two separate portions, so a 3-space divides 4-space into two separate portions between which that 3-space forms an infinitely thin boundary in the fourth dimension. Just as objects in our 3-space are bounded by flat or curved two-dimensional surfaces, so objects of hyperspace are bounded by hypersurfaces, that is flat or curved three-dimensional spaces. Hyperspace contains not only an infinity of flat 3-spaces like ours, but also an infinity of curved 3-spaces or hypersurfaces of different types. A hypersphere, for instance, is a closed hypersurface, all the points of which are equally distant from its center. Freedom of movement is greater in hyperspace than in our space. The degrees of freedom of a rigid body in our space are 6, namely, 3 translations along and 3 rotations about 3 axes, while the fixing of 3 of its points can prevent all movement. In hyperspace however, even with 3 of its points fixed, the body could still rotate about the plane passing through those 3 points. In hyperspace, a rigid body has 10 possible movements, namely, 4 translations along 4 axes, and 6 rotations about 6 planes, while at least 4 of its points, not all in the same plane, must be fixed to prevent all movement. In our 3-space two movements of rotation will combine into a single resultant rotation, similar to its component rotations, except that the direction of the axis is different. In hyperspace however there is no resultant for two rotations, and a body subject to two rotations is in a totally different condition from that which it is in when subject to only one rotation. When subject to one rotation, a whole plane of the rotating body is stationary, the points of the plane turning on themselves while remaining in position. When subject to a double rotation, no part of the body is stationary except the single point containing the two planes of rotation. If the two rotations are equal, every point in the body except that one describes a circle. If the rotations are unequal, the points of the body describe something like a donut. In hyperspace, a sphere if flexible could without tearing and with only slight stretching be turned inside out. Two rings of a chain would fall apart at once, but a chain could be made of alternate rings and hollow spheres. Our 3-space knots would be useless. Just as in our space a point can pass in and out of a circle without touching its circumference, so in hyperspace a body could pass in and out of a sphere or other closed space without going through its surface. In short, all of our space, including the interior of the densest solids is open to inspection and manipulation from the fourth dimension, which extends in unimaginable directions from every point of our space. If one were to ask the direction of hyperspace, the best answer could be that it is sideways to our insides. All this is curious, but of what use is the conception of 4-dimensional space? For one thing, it gives a deeper insight into geometry. Thus, a circle, considered as a one-dimensional aggregate of points, has very few properties, while in a plane it has a center, radii, tangents, etc., and in 3-space has further geometrical relations with the sphere, cone, etc. Similarly, the properties of any given line or surface increase in number when investigated in hyperspace. Also, just as it requires a 3-space to include certain one-dimensional aggregates such as the helix, so in hyperspace previously unknown lines and surfaces such as the pseudosphere become possible. Just as the comprehension of plane geometry is enlarged by viewing plane figures from 3-space, so is solid geometry illuminated by the geometry of hyperspace. Finally, the concept of four-dimen- sional hyperspace effects a complete divorce between geometric space and real space, no longer considered necessarily identi- cal, and in other ways also enlarges our mental horizon. Now that our horizon has been enlarged, it's time to get to today's fractal, which shows a midget in the Z^1.618034+C Mandeloid. The midget is surrounded by so many discontinuities that I named the picture "Discontinuities". Also, to add a bit of tension to the scene, I moved the midget off-center. Since I used most of my energy writing the discussion, the fractal suffered. But with its frenetic filaments and bizarre breaks it still rates a 4, which is only slightly below average. The 7-minute render time of the parameter file is slow enough to make most fractaliers go to: alt.binaries.pictures.fractals or in an hour or so to: for a download of the pre-rendered GIF image file. The fractal weather today was sunny and chilly, with a temperature of 53F (11.5C) that was cold enough to keep the fractal cats confined to the sunshine of the back porch. Although my mathematical philosophy flourished today, my metaphysical philosophy still slept. I'll try again tomorrow to dredge up some wisdom for the deprived masses of fractosophy fans, and one of these days I'll actually have something notable to say. Right now, all I can say is that it's time to shut down the fractal shoppe, settle into my TV chair, and try to avoid getting sucked into the election confusion. I'll put on a junky old sci-fi movie to keep me distracted. Until tomorrow, when I'll return with another fractal and more words, take care, and the less one thinks about the fourth dimension, the happier they'll be. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Discontinuities { ; time=0:07:14.46 -- SF5 on a P200 reset=2001 type=formula formulafile=branchct.frm formulaname=MandelbrotBC passes=1 center-mag=-0.8602\ 1090723480100/-0.09223104404366109/84935.56/1/-75 params=1.618034/0/-3/0 float=y maxiter=25000 inside=0 logmap=120 periodicity=10 colors=000M65<3>J64I64H63<2>E63D63C42<3>8848947A4<49\ >ZpH_qH_rH<2>auIauIbtJ<40>oNgpMgpLh<2>qIjqIjrHmrGosF\ qvDx<10>gG`fGZdGX<3>_HPaJP<3>XGLWFKVEJ<2>SCGQBERCF<6\ 9>rqisrjssj<3>vvmwwmwwm<21>wwm } frm:MandelbrotBC = { ; Z = Z^E + C e=p1 p=real(p2)+PI q=2*PI*trunc(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z|<100 } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: Date: 17 Nov 2000 19:22:03 EST >It depends on how much IP there is in the program. IP? _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Joseph Guth, Ph.D., CIH" Subject: Re: (fractint) Possible virus sent to the list - please delete Date: 17 Nov 2000 22:22:50 -0500 (Mr. Wegner. Please excuse this added virus discussion. If this saves the members of the list from quitting it out of concern of a repeat, then I would say its worth a brief mention before we get back to the subject of interest... Fractint. Here are my 2 cents for what its worth.) Dear Fracint list According to my analysis of the osher@ix.netcom.com attachment, this was sent from a virus infected computer from the email address osher@ix.netcom.com. It is a relatively new worm virus with medium to high damage potential and has been designated the W95_MTX virus. Unless you know how to handle computer virus files safely, it is best to delete any and all emails without opening them from the above address. Dr. Osher Doctorow, the individual who signed an accompanying email from this address should not send any more emails out on this computer until his computer and all removable disks he uses have been virus scanned and cleaned of this highly damaging code. It is obvious that he either doesn't have an antivirus program or doesn't have one with this virus definition in it so it is going to be doing much damage to his own computer in short order. Dr. Doctorow, if you can read this, I would strongly suggest you get some specialized help in salvaging your computer files if you care at all about what is on your hard drive. Otherwise, its best to do a complete low level reformatting of your hard drives and start from scratch. You can contact me directly for more information if you wish. I have several information files on this virus and its capabilities as well as the removal procedure. Sincerely, Joseph H. Guth, Ph.D. President Scientific and Forensic Services, Inc. 4034 Heutte Drive, Norfolk, VA 23518 phone: 757-587-9182 fax: 757-587-8870 email: iri@iname.com ----- Original Message ----- Sent: Friday, November 17, 2000 5:49 PM Folks, please delete the list message from osher@ix.netcom.com with the attachment qi_test.exe. This file triggers virus scanning warnings. I don't know if it is actually a virus, but I suggest you take this warning seriously. Please note the following: 1. Please let us not discuss this or any other viruses on this list. Virus discussion is off topic. (So far I haven't seen any discussion about this on the list - thanks!) You can email me, the list administrator, privately if you think I need to take any action. As list administrator, I can alert the list if necessary, as I am doing now. 2. Attachments to emails on this list are strictly prohibited. If you see one, I suggest you just delete it. Sorry for the trouble, but this is bound to happen occasionally. Tim Wegner Fractint List administrator Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Ken Childress Subject: Re: (fractint) Re: Date: 17 Nov 2000 20:06:25 -0800 Whomever you are, [Drivel deleted] >>Nope. I've been using 2.04 ever since it came out. I maybe get a crash >>once every two or three months. It never locks up the OS. > >Well, either 2.04 crashes a lot or it doesn't. Since the evidence of my >own senses proves to me beyond doubt that it does, and since you are >claiming otherwise and are unlikely to be mistaken in your own beliefs if >you have used the program for more than about three minutes, I am >unfortunately forced to conclude that you are lying. I don't appreciate being called a liar by an anonymous twit. If you are going to make personal accusations, at least have the courage to do so with a real id. There have already been several responses verifying what I stated. I guess they are all liars as well. The solution is simple, don't use UF. In any case, I think all can see you for what you are. >In any case, this is veering way off topic. My apologies to the list and to Tim for this message, but I felt it necessary to respond to this idiot. I shall not do so in the future. Ken... Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: (fractint) Re: Date: 18 Nov 2000 17:11:37 +1300 Multiple Bogeys ask: >IP? Intellectual Property. Ultrafractal's author (whose name escapes me for the moment) has said that most of Ultrafractal's internals are based on public-domain material. Morgan L. Owens "September 28th, 1999 Amazon.com patents cookies." Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Harry Bissell Subject: Re: (fractint) Re: getting OT ??? Date: 17 Nov 2000 23:49:03 -0500 Short for Intellectual Property... without the concept of intellectual property... such fields as engineering and computer science are impossible. H^) harry Multiple Bogeys wrote: > >It depends on how much IP there is in the program. > > IP? > > _________________________________________________________________________ > Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. > > Share information about yourself, create your own public profile at > http://profiles.msn.com. > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul N. Lee" Subject: Re: (fractint) Daniel Goldwater's email address Date: 18 Nov 2000 00:23:43 -0600 Puskás István jr. wrote: > > Does anyone know what Daniel Goldwater's email > address is? I have three different ones listed in the "Fractal Census", but don't know if they are still valid: http://home.att.net/~Paul.N.Lee/Fractal_Census.html Sincerely, P.N.L. http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jim Prickett" Subject: (fractint) Virus From: Date: 18 Nov 2000 10:21:18 -0800 I was sent a blank message containing the attached file qi_test.exe. qi_test.exe is infected by W32/MTX@MM, a combination of a Virus, Worm and Backdoor. See http://vil.mcafee.com/dispVirus.asp?virus_k=98797& for more info. I hope nobody ran this. Jim Prickett jprickett@satcom.net ----- Original Message ----- Sent: Friday, November 17, 2000 12:15 PM Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Bob Margolis Subject: Re: (fractint) Virus From: Date: 18 Nov 2000 12:37:50 -0600 Jim Prickett wrote: > > I was sent a blank message containing the attached file qi_test.exe. > > > I hope nobody ran this. > wHy ¿ wHÅt wÖu£D Hãp pêN If î RÜn iT ¿ ßØß Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Raghav Agnihothri" Subject: Re: (fractint) Virus From: Date: 18 Nov 2000 14:32:12 -0500 I view all my messages using Outlook Express, is that going to create a problem with this virus....(I.e. did I open the mail/virus?)...I deleted when I saw that it was empty with an attachment, and I didn't run the attachment or anything, but I don't know if just looking at it in Outlook Express does anything Raghav ----- Original Message ----- Sent: Saturday, November 18, 2000 1:21 PM > I was sent a blank message containing the attached file qi_test.exe. > > qi_test.exe is infected by W32/MTX@MM, a combination of a Virus, Worm > and Backdoor. See http://vil.mcafee.com/dispVirus.asp?virus_k=98797& > for more info. > > I hope nobody ran this. > > Jim Prickett > jprickett@satcom.net > > ----- Original Message ----- > From: > Sent: Friday, November 17, 2000 12:15 PM > > > > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jim Shaffer, Jr." Subject: Re: (fractint) Re: getting OT ??? Date: 18 Nov 2000 17:54:57 -0500 > without the concept of intellectual property... such fields as engineering > and computer science are impossible. So you're not familiar with Linux, nor with the IBM PC? -- Do what thou wilt shall be the whole of the law. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 19-11-00 (Making a Big Splash [5]) Date: 18 Nov 2000 20:25:16 -0500 (EST) Classic FOTD -- November 19, 2000 (Rating 5) Fractal visionaries and enthusiasts: Today's rather striking fractal makes a big splash. But despite the splash I could rate it no higher than an average 5. While investigating the variety of midgets in the Z^1.618034+C Mandeloid this evening, I came upon this lively little midget. The resemblance to a splash in a bowl of green liquid is so striking that I named the picture "Making a Big Splash". In addition to splashing, the picture also shows that the Mandeloid midgets of orders between +1 and +2 can hold a few surprises, and are not always a disorganized mass of discontin- uous branch cuts. The parameter file renders in 4-1/2 minutes on a 200mhz Pentium machine. The GIF image file, which can be found at: alt.binaries.pictures.fractals and in a hour or so also at: downloads in several minutes less than than 4-1/2 minutes. The fractal weather today here at F.C. was mostly sunny and suitably chilly for late Autumn. The temperature of 46F (8C) held the fractal cats to a brief 10 minutes outdoors. I had a lot more four-dimensional curiosities ready to write about today, but I got bogged down in yard work and never found the time. I'll try again tomorrow. Until then, take care, and to break life's monotony, try a fractal. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Making_a_BigSplash { ; time=0:04:34.40 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotBC passes=1 center-mag=+0.07741527538333934/-0.85262096757411960\ /76711.97/1/-117.499 params=1.618034/0/-2/0 float=y maxiter=12000 inside=0 logmap=88 periodicity=10 colors=000GOAJPEKRIMUMPYQQ_UTaYVe`WhdZji`llappdstfux\ hvz<3>_ukauhZsdVo`RjYOdU<3>9KK5II26F02D040<3>0D00F00\ I20K35M4BO5IQ6KT6MV8PW9RZAU`BWcD_eEcfFfiGjkInnJoqI0o\ J<2>0fL0dM0`M0ZO2VP2TP3QQ4MR4KR5GT6EU6BU9JUBPUEWUGaU\ JiULoUQtVOuUMuTKuRJuRGvQFvPDvOBvOAxM<2>4xK3yJ0yI0yG0\ zE0yG0yI2xK3xL5vO6vP9uQAuTDtUEtWGsYIsZKq`LqaOpdPpeQp\ f<2>JnZGnWFlU<2>8kM5jK4jI2iF0iD0hA0h80e93d95c99aAD_A\ FZAJYBMWBPVBTTDWRDZQDaPEeMEhLEkKFoJFqIFsGI<2>uDMvDOx\ BQyARy9Uz8Vz8Wz6Z<2>z3cz2j<3>z4oz5pz5q<2>z6utAvkExcG\ yVKzMMzEQz4Uz<4>D_zE`zFazIczJdzKezLfzOhzPizQjzTkzUlz\ VnzWpzZqz_sz`tzcuz<3>Yzz<8>azzazzczz<3>dzzezzezzizz<\ 4>RzzOzzKzz<3>6zz<3>4zz3zz3zz0zz3zz5zz9zzBzzEzzIzzKz\ zOzz<3>Zzzazzdzzfzz9zz8zz8zzAzzDzzEzz } frm:MandelbrotBC = { ; Z = Z^E + C e=p1 p=real(p2)+PI q=2*PI*trunc(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z|<100 } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Barry N. Merenoff" <110144.2274@compuserve.com> Subject: (fractint) Message to Mr. Doctorow Date: 18 Nov 2000 21:11:46 -0500 Dear Mr. Doctorow, Not only should you remove the virus from your system, but also y= ou should get an air conditioner for your computer room, and you should make= sure your CPU's vent slits are uncovered. Sincerely, Collin Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: Date: 19 Nov 2000 00:00:07 EST >I don't appreciate being called a liar [irrelevancies deleted]. You have some nerve saying this, when the last time you posted you called *me* a liar. _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Paul DeCelle Subject: Re: (fractint) Re: Date: 19 Nov 2000 00:58:28 -0500 Um, As the one who (inadvertently) started all this, I apologise. I thou= ght I was responding privately to b=E4rbel when I wrote. My mistake. Regards, Paul Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: davides Subject: Re: (fractint) Re: (For Paul) Date: 19 Nov 2000 06:23:46 -0500 At 12:58 AM 11/19/2000 -0500, you wrote: >Um, As the one who (inadvertently) started all this, I apologise. I thought I was responding >privately to b=E4rbel when I wrote. My mistake. > >Regards, Paul 'tain't your fault, Paul. BTW, glad you liked that one image I posted on abpf (the one "for Paul"); if I can find time, I intend on doing one especially for you in UF. It would have to be something special considering the quality of of the great art you post! :) David S. davides@pipeline.com Back up my hard drive? How do I put it in reverse? Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jonathan Osuch" Subject: (fractint) Fractint version 20.1.03 Date: 19 Nov 2000 12:18:48 -0600 The latest patch and executable of Fractint version 20.1 are now available at www.fractint.org The executable is fradev.zip. It fixes the incremental redraw problem with setting passes=1 after being interrupted. The range of bailout values that work with ap-math is now larger. Still nothing to write home about. A new command line option has been added, nobof=yes, which causes the inside=bof60 and bof61 options to NOT recreate the images from the book of the same name. This makes the behavior of these two inside options the same as the other inside options. Jonathan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "James R. McKenzie" Subject: Re: (fractint) Virus From: Date: 19 Nov 2000 16:11:25 -0500 I got it too but Norton AV (Version 7.0x) caught it. Dammit can't these little snots who write these things get a damned life?!?! T H A N K Y O U James R. McKenzie jimmckenzie@earthlink.net ----- Original Message ----- Sent: Saturday, November 18, 2000 1:21 PM > I was sent a blank message containing the attached file qi_test.exe. > > qi_test.exe is infected by W32/MTX@MM, a combination of a Virus, Worm > and Backdoor. See http://vil.mcafee.com/dispVirus.asp?virus_k=98797& > for more info. > > I hope nobody ran this. > > Jim Prickett > jprickett@satcom.net > > ----- Original Message ----- > From: > Sent: Friday, November 17, 2000 12:15 PM > > > > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > > Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Rafael Lepra" Subject: (fractint) RE: Date: 19 Nov 2000 22:16:18 -0300 This is a multi-part message in MIME format. ------=_NextPart_000_0000_01C05276.57B3E5C0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 7bit I will never open the attached file without knowing you. Rafael Lepra -----Mensaje original----- De: owner-fractint@lists.xmission.com [mailto:owner-fractint@lists.xmission.com]En nombre de osher@ix.netcom.com Enviado el: Viernes 17 de Noviembre de 2000 05:16 PM Asunto: ------=_NextPart_000_0000_01C05276.57B3E5C0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable

I will=20 never open the attached file without knowing you.
 
Rafael=20 Lepra
-----Mensaje original-----
De:=20 owner-fractint@lists.xmission.com=20 [mailto:owner-fractint@lists.xmission.com]En nombre de=20 osher@ix.netcom.com
Enviado el: Viernes 17 de Noviembre = de 2000=20 05:16 PM
Asunto: =

------=_NextPart_000_0000_01C05276.57B3E5C0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: Date: 19 Nov 2000 20:25:46 EST >Go back and reread the messages. I made no comment on you personally. >I posted a response that said my experience differed from yours. >Several others also posted that their experience did not agree with >you. I never said anything about you lying, or being wrong with >what you observed. Sophistry. Pure sophistry. You and I both know that either 2.04 crashes frequently or it doesn't, and that nobody is likely to be mistaken in their belief about which it does if they have used it for any length of time. So either everyone who says it crashes a lot is lying, or everyone who says it doesn't is lying. We can't both be right, not unless there are two *different* UltraFractal 2.04s out there! So whereas you may not have explicitly called me a liar, you sure as hell implied it. _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Subject: Re: (fractint) Re: Date: 20 Nov 2000 14:28:08 +1300 Multiple Bogeys said: > > Sophistry. Pure sophistry. You and I both know that either 2.04 crashes > frequently or it doesn't, > I'm sorry, I didn't realise I'd accidentally subscribed to the Ultrafractal list. Morgan L. Owens "You _don't_ mean 20.4, do you." Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Fractint version 20.1.03 Date: 19 Nov 2000 20:30:42 EST >A new command line option has >been added, nobof=yes, which causes the inside=bof60 and bof61 options to >NOT recreate the images from the book of the same name. This makes the >behavior of these two inside options the same as the other inside options. Could you please elaborate on this? How is it that they currently don't behave the same as the other inside options? _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Share information about yourself, create your own public profile at http://profiles.msn.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jason Hine" Subject: (fractint) SOI and LogMap? Date: 19 Nov 2000 17:48:45 -0800 Folks, I've been playing with the SOI implementation at 20.0, and I'm delighted. Huge kudos to Michael Ganss and all those who worked on getting this into Fractint! I'll apologize in advance for asking a question that's likley been asked dozens of times on this list already: is it possible to use the SOI drawing method in conjunction with a logmap palette? If not, I'd like to make that an enhancement request... might this already have been done in a more recent build? Might there be another way to accomplish the same thing, perhaps by creating a truecolor=yes Targa and manipulating the pixel values in another image editing software? Has anyone found any workarounds? Thanks for the fracts, Jason Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Tim Wegner Subject: Re: (fractint) SOI and LogMap? Date: 19 Nov 2000 19:59:41 -0600 Jason wrote: > I've been playing with the SOI implementation at 20.0, and I'm delighted. Huge > kudos to Michael Ganss and all those who worked on getting this into Fractint! I integrated SOI (Synchronous Orbits - a technique for greartly accelerating speed of deep zooms) into Fractint. > I'll apologize in advance for asking a question that's likley been asked dozens > of times on this list already: is it possible to use the SOI drawing method in > conjunction with a logmap palette? SOI is rather loosely integrated with Fractint. Most normal fractint options have no effect. SOI in fractint is almost like a standalone program, that just has a simple escape-time coloring algorithm with few if any options that work with other fractal methods. If fractint manages to continue to evolve (we are in a situation now where Jonathan Osuch is the only one working on it, so development consists only in what Jonathan is able to do), enhancing SOI and integrating it better with Fractint would be high on a to do list. Since SOI is only valuable right at the limit of zooming of double precision, a really interesting thing to do would be to extend SOI to arbitrary precision. This might make deep zooming explorartion more feasible. Tim Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 20-11-00 (Cut-outs [4]) Date: 19 Nov 2000 23:28:21 -0500 (EST) Classic FOTD -- November 20, 2000 (Rating 4) Fractal visionaries and enthusiasts: I have little to say about today's unassuming image. It's a somber picture, with the overall gloom somewhat offset by the brilliant midget at the center. The rings of perfectly-shaped holes surrounding the midget inspired the name "Cut-outs". After studying the image for several minutes, I decided that it rated no more than a 4. The parameter file's fast render time of 3 minutes makes up for the slightly below average rating of the image. If this is still too slow, the GIF file may be found pre-rendered and ready for download at: and at: The fractal weather today was cloudy and cold, with a temperature of 36F (2C) that was far too chilly for the disappointed fractal cats. Since it will be even colder for the rest of the week, the cats will have to stay disappointed. As for myself, I'm shutting down the fractal shoppe and calling it a night. Until next time, take care, and who put those holes in my fractal? Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Cut-outs { ; time=0:03:19.87 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+0.49255346013993960/-14.3928154883796000\ 0/570410/1/67.5 params=1/1.618034/1/16.18034/0.3/0 float=y maxiter=1400 inside=0 logmap=49 periodicity=9 colors=000<3>00003106607A<3>0JS0MX0Q`0Xd0ai0imOpsgrz\ mssgpmcmiYlcSl_OjTIjPCiJ7iFCfJGcOL`SP_XSX`XTd`SidPmg\ MrlLvpIzuFzxDzvIzvLzvOyvQuvTrvYov`j<3>vmYvpVvsQvvOvy\ LvzI<2>ddJ_YJTQJ<2>C4J60J10J70OC6QGDTLLX<3>amifulzs0\ zm0ug0pa0jX0dQ0`L0_sxdpviouolssjrxirfjCdfGcaJa_M`VP_\ STYOXXJ_VGaTCfS9iQ4lP1oL9gIFaDLXASP6YJ3cD9`IFYLJVPPT\ STXV___caaiddogisjlymo<2>zvyzyzzzzyzzuzzozz<3>YzzTzy\ QzrMzlIzfFz_AzT7zO4zL3zI1zF<3>0z30z00z3<4>0zA0zC0zF<\ 3>1zL1zM1zO<2>0zG0zD0zC<2>0z40z10z00z00z04z0Dz1Mz3Vz\ 6dz9mzAvzDzzFyzCszAmz9gz7az4Xz3Qz1<2>9z03z00z00z07z3\ <2>sz`rzdrzgrzjpzmpzppzsozxozzozzmzzmzzmzzmzzozz<2>p\ zzpzzrzzrzzrzyszvszuszsdzmQzgDzcOzVYzOgzFrz7YzADzD<2\ >4zQ1zV0z_<2>0zlLzamzT0zpAzoOzm_zllzjxzj7z00z0<7>0z0 } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Guy Marson Subject: Re: (fractint) SOI and LogMap? Date: 21 Nov 2000 00:06:08 +0100 At 19:59 19/11/00 -0600, you wrote: >Jason wrote: > >> I've been playing with the SOI implementation at 20.0, and I'm delighted. Huge >> kudos to Michael Ganss and all those who worked on getting this into Fractint! > .... >If fractint manages to continue to evolve (we are in a situation now >where Jonathan Osuch is the only one working on it, so >development consists only in what Jonathan is able to do), >enhancing SOI and integrating it better with Fractint would be high >on a to do list. he, give us some examples.. where are some .par's of it? Here is another request: Is it possible to implement ?Sylvie Gallet's "ismand" feature (the lake like fractals) into fractint (into the x,y or z screen) so that "ismand" can bee applyed on every fractal typ? > >Since SOI is only valuable right at the limit of zooming of double >precision, a really interesting thing to do would be to extend SOI to >arbitrary precision. This might make deep zooming explorartion >more feasible. > >Tim > > I got one more question: Why is there such a big jump in the following [bailout.par] when amounting the bailout from 113 to 114? There are no changements <113 and >114. On other Bailout Tests are other values but the same jumps.. no changements before and after a certain value. 0-mod-113 { ; Version 2001 Patchlevel 1 reset=2001 type=julibrot julibrotfromto=-1/-1/0/0 julibrot3d=128/1220/60/5/10/24 julibroteyes=-5.05 orbitname=julzpower 3dmode=lefteye center-mag=0/0/25/1.0003 params=0/0/4/0 maxiter=6 bailout=113 viewwindows=4.2/0.75/yes/0/0 colors=@altern.map } 0-mod-114 { ; Version 2001 Patchlevel 1 reset=2001 type=julibrot julibrotfromto=-1/-1/0/0 julibrot3d=128/1220/60/5/10/24 julibroteyes=-5.05 orbitname=julzpower 3dmode=lefteye center-mag=-0/0/25/1.0003 params=0/0/4/0 maxiter=6 bailout=114 viewwindows=4.2/0.75/yes/0/0 colors=@altern.map } Both are 3d-fractals for crossed-eyes viewing.. **** Remember: the floating point must be switched of! **** Cheers, Guy Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 21-11-00 (Fantasia in Red [6]) Date: 20 Nov 2000 23:15:48 -0500 (EST) Classic FOTD -- November 21, 2000 (Rating 6) Fractal visionaries and enthusiasts: The formula 2Z^(-1.111)+2Z^(-16.67)+(1/C) is behind today's fractal, which I decided to name "Fantasia in Red" and rate a slightly above average 6. There's not much to be said about the image, which speaks for itself. So I'll not say much, except to tell that the parameter file is a rather slow one, taking almost 14 minutes to render. To avoid impatience, I recommend downloading the GIF image from: or from: The fractal weather today was partly cloudy with a temperature of 50F (10C) -- enjoyable outdoor conditions for the cats. But an intense squall struck in the afternoon, with a dramatic drop in the temperature and flurries of snow that sent the dynamic duo scurrying indoors. And I'm out of energy and about to scurry for my favorite chair. The philosophy didn't even come close today. Maybe I'm all philosophized out. Regardless, we'll have another fractal tomorrow at the regular time. Until then, take care, and realize that fractal images exist only because we wish them to. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Fantasia_in_Red { ; time=0:13:47.22 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+70.00933328451245000/+43.860611755854760\ 00/130806.7/1/-107.5 params=1/-1.111/1/-16.67/1/400 float=y maxiter=1200 inside=0 logmap=159 periodicity=9 colors=000AFH<3>EITEIVFIX<2>HI`HJbIIc<3>KHiKHjLGk<2>\ MFpNFqLDt<4>SKnTLlUMkWOj<2>ZQg<2>TL_SKYQKV<3>JHMHGJG\ FH<3>9C7CB5FA1IB3LB4OC5RE6<3>bGAeGChHDkHE<2>vIHyIIzL\ MyIJuGGrEDmB9<3>YFGUGIRHJPHLNINLJYKKdILfGMgENiEPaDN_\ CJQCFG<5>QELSDLUDM<2>`DObDPeEO<12>aATaATaAT<3>`9U<3>\ HNiCQm8Tq<3>UjVZnPcrJixD<13>cdRbcSbbT<3>`XX`YW<3>Ta_\ Rb`IYP6TB<8>QVVSVXVVZ<3>bVf<7>JidHkdEmd<3>5td<3>WvFb\ v8hv2<12>jM9jJAjGA<3>j5CeLR`NeXPt<3>`Xh`Zfa`c<3>dhT<\ 3>Xp_VraTtbRvdPxeXztdzueztfzsszVuzTvzRszSMzb<5>Azl7z\ x<2>AzU } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Barry N. Merenoff" <110144.2274@compuserve.com> Subject: Re: (fractint) Re: Date: 21 Nov 2000 03:52:58 -0500 Don't you get it? There's something wrong with your computer that prevent= s it from running UltraFractal. Other people can run UltraFractal because their computers don't have the problem yours has. Why don't you find someone who can help you clear up the problem, instead of naysaying everyone who tries to mention it to you? Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 22-11-00 (Another Starfish [6]) Date: 21 Nov 2000 19:53:09 -0500 (EST) Classic FOTD -- November 22, 2000 (Rating 6) Fractal visionaries and enthusiasts: I've got little to say again today. The reason is that I'm kind of depressed and disillusioned by the national events. I get these spells every now and then, but this is an unusually deep one. Regardless, I did work up the enthusiasm to find a fractal image today. I found it in the fractal that is created by the formula Z^(-1.123)-Z^1.123+(1/C), which I chose purely on a whim. I named the picture "Another Starfish". I gave it this name because I believe I have already named an FOTD "Starfish". When I saw the finished product, I rated it a 6, which is a bit above average. The draw time of the parameter file is a slow 13 minutes, making a download of the image file far more time efficient. The download can be found at: and in a couple hours at: The fractal weather today was windy and cold, with a temperature of 38F (3C) that was far too chilly for the fractal cats. They responded by spending the day by the radiators of their choice. When I'm in this kind of a down mood, I can't philosophize, so we have no philosophy today, (not that it's missed). But all things eventually come to an end, and eventually I'll find the inspiration to spread my philosophy once again. That's it for today. Until tomorrow, take care, and be patient. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Another_Starfish { ; time=0:12:55.93 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=-0.257674116207993/-0.133877987035905/4.8\ 38896e+009/1/130 params=-1/1.123/1/-1.123/0/0 float=y maxiter=1600 inside=0 logmap=218 periodicity=10 colors=000KFFKFFMGJ<3>NMZUNbQOf`Qj`RnjSsmUwpUysUwpUt\ mUqfUp`UmUUjQUi<2>FUaEU`EUYCUVBUUBVR9XO9YN1YV0Ya0`Z0\ aY1dX4eV7fU8iSBjQEmOFnNIpMKsKMtJOzMRxFSzaVzCYzfZz9Yz\ fYy8Yx7Yu7YuBYt5Xp4Xm4Xl3Xh3Xh1Xf1Xe1`f7dhBhjFmmJsnO\ wqSztXzw`zxdztespfjmhbiiUfdMbZF`U8XU1UUFdUSmUewUqzFp\ zJnzN<2>lzZlzbjzfizjiznhzsfzwfzyeztdypdulbqhbmdai`ae\ V`aR`YNZUJ<2>YI7`G8aF9bE9dCBeBBf9Ch8Ci7Ej5El4Fm3Fp1G\ q0I<3>w0Kx0Ky0M<3>z0Oz0Oy0Q<3>t0Ss0Sq0Up0Un1Vm3Vl4Xj\ 4Xi5Yh7Yf8Ze8Zd9`bB`aCa`CaZBYYBVXBSXBQVBNUBKSBIS9FR9\ CQ99O97O94N91M90M90NB0<2>OB0OB1QB3<2>RC5RC5RC7SC8SC8\ UC9UEBUEBVECVEEVEEXEFXEGXEGVIEUKCUNBSQ9SU8UX5VZ4Xa3Y\ e1Zh0`j0<2>dt0ew0fy0hz0iw0jq0lt0mt3nt7pt9qtEstG<3>xt\ UztYzt`<2>zxdzyezzezz`zzXzzRzzNzzIzzEzz8zz4zz0<2>zz0\ <3>zz9zzCzzFzzIzzJzzMzzF<4>zzF } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Subject: (fractint) updated website Date: 21 Nov 2000 22:49:16 -0500 This is a multi-part message in MIME format. ------=_NextPart_000_0017_01C0540D.469BD660 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable I invite you to visit my Euler Gallery, Pages 1 & 2, where I have = uploaded 16 new images. The parameters are available for download.=20 Regards, Gedeon FRACTALS: http://members.nbci.com/gedeonp/fractals.html Last updated: November 21, 2000 Member Infinite Fractal Loop PHOTOGRAPHY: http://members.nbci.com/gedeonp/photos.html Last updated: July 10, 2000 ------=_NextPart_000_0017_01C0540D.469BD660 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
I invite you to visit my = Euler=20 Gallery, Pages 1 & 2, where I have uploaded 16 new images. The = parameters=20 are available for download.
 
Regards,
 
Gedeon
--------------------------------------------------------------FRACTALS:=20 http://members.nbc= i.com/gedeonp/fractals.html
Last=20 updated: November 21, 2000
Member Infinite Fractal = Loop
PHOTOGRAPHY: http://members.nbci.= com/gedeonp/photos.html
Last=20 updated: July 10,=20 2000
--------------------------------------------------------------
------=_NextPart_000_0017_01C0540D.469BD660-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 21-11-00 (Fantasia in Red [6]) Date: 22 Nov 2000 01:19:00 -0500 I hate to say it but something's wrong with the FOTD again -- and it isn't just some delay. The individual FOTDs are there (at least, those that are in my browser history still -- including ones not cached anymore), but the index page http://home.att.net/~Paul.N.Lee/FotD/FotD.html is 404. This looks like a case of vandalism. I suggest you re-upload the index page and hit your ISP's customer service people over the head with the Cloobat(tm). Your ISP obviously hasn't been keeping the security patches of their Web server up to date, or else one of their employees is disgruntled and committing acts of sabotage. If the ISP does not respond to your complaints in a satisfactory manner I suggest changing to another provider. _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: Date: 22 Nov 2000 01:26:37 -0500 >Don't you get it? There's something wrong with your computer that prevents >it from running UltraFractal. Yeah, right. Everything else works, just not UltraFractal. If something were wrong with the machine or the OS, nothing would work, or at least lots of things wouldn't work. If a single app isn't working, and everything else works fine, I'm forced to conclude that the app is the problem, and not the system. I am aware that memory or overheating errors often don't show themselves until you do something really compute-intensive, such as compiling a Linux kernel. However, I run stuff that stresses the system a lot more than UltraFractal does -- Quake grinds the cpu, memory, and video system hard, Fractint really grinds the cpu, etc. Also, I run Prime95 -- if there were a memory fault or a similar problem, it would be showing up as errors there. Prime95 plays with all of the memory on the machine, and is very sensitive to memory/cpu problems. As for OS problems or video problems, they'd affect every graphical app on my system. _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: davides Subject: Re: (fractint) C-FOTD 21-11-00 (Fantasia in Red [6]) Date: 22 Nov 2000 05:34:12 -0500 At 01:19 AM 11/22/2000 -0500, you wrote: >I hate to say it but something's wrong with the FOTD again -- and it isn't >just some delay. The individual FOTDs are there (at least, those that are in >my browser history still -- including ones not cached anymore), but the >index page http://home.att.net/~Paul.N.Lee/FotD/FotD.html is 404. This looks >like a case of vandalism. I suggest you re-upload the index page and hit >your ISP's customer service people over the head with the Cloobat(tm). Your >ISP obviously hasn't been keeping the security patches of their Web server >up to date, or else one of their employees is disgruntled and committing >acts of sabotage. If the ISP does not respond to your complaints in a >satisfactory manner I suggest changing to another provider. Strange - worked for me, right from the link given above. davides@pipeline.com Give a man a fish and he eats for a day.... Teach a man to fish and he spends his whole day drinking beer!!! Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Osher Doctorow" Subject: (fractint) Virus cleaned out - thanks for warning - Doctorow Date: 22 Nov 2000 15:11:57 -0800 Thanks to warning from fractint and its affiliates in charge of virus protection, I was able to eliminate my computer's virus within 48 hours. It had infected the entire Windows 98, which required re-installing a new version of Windows 98. I now have a virus protection which I update every few days. According to computer experts, viruses are so frequent in the USA that antivirus (AV) programs need to be updated every week. I had previously (about a year ago) been infected by a Kak virus, which was cleaned out but left behind an alteration in my registration and signature components and gave occasional false alarms. Windows is especially susceptible to the Kak virus. It is a curious fact that I sent an email to fractint concerning mathematics in studying biological/medical viruses when the virus hit my computer, but it is also a good example of the fact that people should not be assumed to be guilty even when coincidences occur (which they do more often than is generally believed). If anybody had bothered to ask me, I would have told them that I have never been a computer programmer or computer engineer (I do consult in mathematics/statistics and physics) and therefore could not possibly create a computer virus. They could have checked my employment references. What I am guilty of is belonging to very many internet discussion groups/mailing lists, and presumably that is where I got the virus on both occasions (although I have also run into "flames", so there is more than one route to get a virus theoretically). The benefit of belonging to such groups is that I am more inspired to do creative research in mathematics, and I will try to continue along that path. Osher Doctorow Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 23-11-00 (Fractalesque [7]) Date: 22 Nov 2000 23:39:58 -0500 (EST) Classic FOTD -- November 23, 2000 (Rating 7) Fractal visionaries and enthusiasts: A descriptive name for today's fractal eluded me, so I settled on the generic title "Fractalesque". The name has a rather festive sound to it, which goes along with the festive appearance of the image. And it's better than no name at all. Due to the unusual blue and orange elements surrounding the brilliantly decorated central midget, I raised my rating from 6 to 7. The formula behind the image is Z^1.5+0.1Z^(-15)+(1/C), another of the totally whimsical expressions I conjure up while using the MandelbrotMix4 formula. The parameter file renders in 9-1/2 minutes, a time long enough to make a download of the GIF image file the better choice. And speaking of a download, the file may be found on Usenet at: and on the W.W.W. at: The fractal weather today here at Fractal Central was sunny but quite cold. The temperature of 30F (-1C) was far too chilly for the fractal cats, who slept curled by the radiators most all day. I've still got more fractal image inspiration than literary inspiration, so there will be no philosophy for today. For tomorrow? -- only time will tell. And I see that the time has arrived to shut down the fractal shoppe and call it a night. Until next time, take care, and wish for the best. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Fractalesque { ; time=0:09:38.32 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=-14.18706546711465000/-0.2322107332456753\ 0/2.592652e+007/1/77.5 params=10/1.5/1/-15/-0.9/0 float=y maxiter=2000 inside=0 logmap=172 periodicity=9 colors=00080LD0NH0LK1JO3HR6EV8DZA9aD8eH6jK2oO0sR0xU0\ zT0zQ5zO9zKEzIJzGOzDPzAPy9Lx8Jw6Gv5Du39s17r03r01<3>p\ 5Op6Uo7_o8eo9jmApmCvmDzkIojNcgRRfWGe_5`c3Wf3Rh3Ol3Up\ 3_r3<3>ws2zs2ws2<2>es2hs2ks2fm8aeEYUJTLPODUJ5_G0dK0a\ O2`<2>ZAWaDVeHThJRlLQ<2>m`RmeRojR<2>oxRozRmgYmNcoJ_o\ HWoEUoCQo9Oo6K<3>o6Zo6ao6em6hm6hm2kl6jk9hjDhjHghKggO\ fgQffPcfOwfNzfLV<3>fHKfGIfEEfDCfD9gN6hW2he0jo0jx0<2>\ fv0eu0es1ds2cr3ar5<3>Zo9ZoAAmzGkx<3>Ya`a_UfYO<3>wO0<\ 3>jQEfRIdRL`TPYTR<3>LVeIWhEWlCWoG_`IcOKfANj0Qh2Uh7Wg\ C_gHcfKefPheUleZodcrdfvckxcpzauzaxgK`<2>6Od<12>6cs6d\ u6ev<3>6jz6kz6lz<2>6pz6qz6qz<11>6qz6qz6qz<3>6qzAqz<1\ 8>8qz } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: Re: (fractint) C-FOTD 23-11-00 (Fractalesque [7]) Date: 23 Nov 2000 11:24:27 -0000 Wow! Now *that* is what I call a colour scheme. Fantastic! Jim, you are an inspiration to us all! >From: Jim Muth >Reply-To: fractint@lists.xmission.com >To: fractint@lists.xmission.com >CC: philofractal@lists.fractalus.com >Subject: (fractint) C-FOTD 23-11-00 (Fractalesque [7]) >Date: Wed, 22 Nov 2000 23:39:58 -0500 (EST) > > >Classic FOTD -- November 23, 2000 (Rating 7) > >Fractal visionaries and enthusiasts: > >A descriptive name for today's fractal eluded me, so I settled >on the generic title "Fractalesque". The name has a rather >festive sound to it, which goes along with the festive >appearance of the image. And it's better than no name at all. > >Due to the unusual blue and orange elements surrounding the >brilliantly decorated central midget, I raised my rating from 6 >to 7. > >The formula behind the image is Z^1.5+0.1Z^(-15)+(1/C), another >of the totally whimsical expressions I conjure up while using >the MandelbrotMix4 formula. > >The parameter file renders in 9-1/2 minutes, a time long enough >to make a download of the GIF image file the better choice. And >speaking of a download, the file may be found on Usenet at: > > > >and on the W.W.W. at: > > > >The fractal weather today here at Fractal Central was sunny but >quite cold. The temperature of 30F (-1C) was far too chilly for >the fractal cats, who slept curled by the radiators most all day. > >I've still got more fractal image inspiration than literary >inspiration, so there will be no philosophy for today. For >tomorrow? -- only time will tell. > >And I see that the time has arrived to shut down the fractal >shoppe and call it a night. Until next time, take care, and >wish for the best. > > >Jim Muth >jamth@mindspring.com > > >START 20.0 PAR-FORMULA FILE================================ > >Fractalesque { ; time=0:09:38.32 -- SF5 on a P200 > reset=2001 type=formula formulafile=critical.frm > formulaname=MandelbrotMix4 function=recip passes=1 > center-mag=-14.18706546711465000/-0.2322107332456753\ > 0/2.592652e+007/1/77.5 params=10/1.5/1/-15/-0.9/0 > float=y maxiter=2000 inside=0 logmap=172 periodicity=9 > colors=00080LD0NH0LK1JO3HR6EV8DZA9aD8eH6jK2oO0sR0xU0\ > zT0zQ5zO9zKEzIJzGOzDPzAPy9Lx8Jw6Gv5Du39s17r03r01<3>p\ > 5Op6Uo7_o8eo9jmApmCvmDzkIojNcgRRfWGe_5`c3Wf3Rh3Ol3Up\ > 3_r3<3>ws2zs2ws2<2>es2hs2ks2fm8aeEYUJTLPODUJ5_G0dK0a\ > O2`<2>ZAWaDVeHThJRlLQ<2>m`RmeRojR<2>oxRozRmgYmNcoJ_o\ > HWoEUoCQo9Oo6K<3>o6Zo6ao6em6hm6hm2kl6jk9hjDhjHghKggO\ > fgQffPcfOwfNzfLV<3>fHKfGIfEEfDCfD9gN6hW2he0jo0jx0<2>\ > fv0eu0es1ds2cr3ar5<3>Zo9ZoAAmzGkx<3>Ya`a_UfYO<3>wO0<\ > 3>jQEfRIdRL`TPYTR<3>LVeIWhEWlCWoG_`IcOKfANj0Qh2Uh7Wg\ > C_gHcfKefPheUleZodcrdfvckxcpzauzaxgK`<2>6Od<12>6cs6d\ > u6ev<3>6jz6kz6lz<2>6pz6qz6qz<11>6qz6qz6qz<3>6qzAqz<1\ > 8>8qz > } > >frm:MandelbrotMix4 {; Jim Muth >a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), >g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, >k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): >z=k*((a*(z^b))+(d*(z^f)))+c, >|z| < l >} > >END 20.0 PAR-FORMULA FILE================================== > > >-------------------------------------------------------------- >Thanks for using Fractint, The Fractals and Fractint Discussion List >Post Message: fractint@lists.xmission.com >Get Commands: majordomo@lists.xmission.com "help" >Administrator: twegner@fractint.org >Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 24-11-00 (Liquid Mandeloid [6]) Date: 24 Nov 2000 00:30:05 -0500 (EST) Classic FOTD -- November 24, 2000 (Rating 6) Fractal visionaries and enthusiasts: After a busy Thanksgiving day holiday, I have little time for notes, though the fractal for today is notable. The iterated formula behind the image is -15Z^(-1.15)-Z^(-11.5)+(1/C), another totally whimsical expression. I named the image "Liquid Mandeloid" when I noticed that the entire image appears as though it were reflected in a rippling pool of water. Having named the picture, I studied it a moment before deciding on its rating of 6. With a render time of almost 47 minutes, the image is quite slow when drawn from the parameter file. But impatience may be avoided by downloading the pre-rendered GIF image file from the internet, where it has been posted to: and to: The fractal weather today here at Fractal Central was cold and sunny. The afternoon temperature of 34F (1C) was far too cold for sensitive fractal cats to be out of doors. They spent the day as usual by the radiators. That's it for tonight, but I'll be back tomorrow with fractal and notes. Until then, take care, and could a race that had never developed vision be familiar with the Mandelbrot set? Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Liquid_Mandeloid { ; time=0:46:27.52 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+2.71630165554769200/-0.94733691371325090\ /3.034843e+008/1/180 params=15/-1.15/1/-11.5/-2/500 float=y maxiter=3600 inside=0 logmap=364 periodicity=9 colors=000REEUFFWGGdHH<3>KMMFOO6PPAQQCRR<2>MVVPWSSWR\ VYPYYO`ZLc_Jg_Hi`Fm`EobBsbAvc7zd1xc6vcArbEobHmbHibFh\ bFjbEkbEmbCn`C<3>s`Bt_Bv_Aw_Ax_At`Br`Co`E<2>h`Ge`Hc`\ J<3>U`MR`MP`OM`PK`QJcOH`QG_RFZSEWVCVWBUYAR_8Q`7Pb6Oc\ 5Le4Kg2Jh1Gj0Fk0Em0Cn<3>5Bi6Ah7Ag8AeAAdC6bBAcBCcBFcA\ HcALcAOc8Qc8Sc8Wd7Zd7`d7cd6gd6id6kd1qg6nd<2>HjZkiWPh\ VtgSWeRtdPdcMx`Li`JzYGnZFwYCsWBvVBxUBwUBvSBsSBrRBoRB\ nQBmQBoOFqLHrKLsHOtFRvEUwBYxA_y7cz5ez4iz1kz0oz0rz0vz\ 0xz0wz2w<3>zHwyLwxPwxUw<3>shwrkwqowoswnyzowwovsqtqqs\ mrqirogrncsm`sjYtiUthRvgOvdKvcH<3>xY4yW1yV0yU0rV0<3>\ U_KO`PMbEHcU0d07eFLgUZhh_ii`ji`kibmi<3>eriesigti<3>j\ yijzikziozkkziizggzddzb`z_ZzYWzV<3>LzLJzJGzGCzE<2>5z\ 60z52z45z4<5>Gz4Hz4Kz4Lz4Oz4Pz4Rz4Sz4Vz4Wz4RzCMzLGzQ\ JzSKzUMzV } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jonathan Osuch" Subject: Re: (fractint) SOI and LogMap? Date: 24 Nov 2000 10:26:13 -0600 Guy, > I got one more question: Why is there such a big jump in the following > [bailout.par] when amounting the bailout from 113 to 114? There are no > changements <113 and >114. On other Bailout Tests are other values but the > same jumps.. no changements before and after a certain value. If you set those parameters (params=0/0/4/0 bailout=113) in the julzpower type and switch back and forth between floating point and integer math, you'll notice that what you are looking at are artifacts due to the limited dynamic range of the integer math. This carries over into the julibrot fractal type. I wouldn't worry about why the big jump occurs since the integer math routines will be going away eventually. Jonathan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Harry Bissell Subject: Re: (fractint) SOI and LogMap? Date: 24 Nov 2000 11:38:17 -0500 Integer modes going away ??? Will it be called FractFloat (or similar) then ??? H^) harry Jonathan Osuch wrote: > Guy, > > > I got one more question: Why is there such a big jump in the following > > [bailout.par] when amounting the bailout from 113 to 114? There are no > > changements <113 and >114. On other Bailout Tests are other values but the > > same jumps.. no changements before and after a certain value. > > If you set those parameters (params=0/0/4/0 bailout=113) in the julzpower > type and switch back and forth between floating point and integer math, > you'll notice that what you are looking at are artifacts due to the limited > dynamic range of the integer math. This carries over into the julibrot > fractal type. I wouldn't worry about why the big jump occurs since the > integer math routines will be going away eventually. > > Jonathan > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) Re: C-FOTD 23-11-00 Date: 24 Nov 2000 17:23:54 -0500 (EST) At 11:24 AM 11/23/00 -0000, Andrew Coppin wrote: >Wow! Now *that* is what I call a colour scheme. Fantastic! Jim, you >are an inspiration to us all! I'm glad you enjoyed my modest effort. It's too bad that my literary inspiration is currently lagging so far behind my fractal luck. But I've had these fallow periods before. They always pass eventually. C-FOTD to follow in a few hours. Until then, take care, and do we find fractals or create them? Jim M. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 24-11-00 (Heliosphere [6]) Date: 24 Nov 2000 18:54:32 -0500 (EST) Classic FOTD -- November 25, 2000 (Rating 6) Fractal visionaries and enthusiasts: Today's fractal reminds me of a cross section of the sun, with its churning plasmas and magnetic fields. This is why I named it "Heliosphere". Studying the image, I considered rating it a 7, but due to my continuing down mood, I rated it a 6, which is above average but not outstanding. The image was created by iterating the fractal formula -15Z^(-1.15)-Z^(-11.5)+(1/C), with the escape radius set at 600. These are the same parameters as those of yesterday's "Liquid" fractal, and today's image is therefore part of the same fractal as yesterday's. The parameter file render time of 14-plus minutes is faster than yesterday's, but still slow enough to make the easy download the better choice. That download may be found on Usenet, posted to the binary group: In an hour or so, the image will also be available on Paul Lee's web site at the URL: The weather today here at Fractal Central moderated from the unseasonable cold that has prevailed most of this week. The temperature of 40 however was still far too chilly for the dynamic duo of fractal cats, who chose to pass the afternoon on their blanket by the big radiator. At least the cats were happy. As for me, I'm still in my melancholy mood, which affects my literary inspiration much more than my fractal luck. Strangely enough, I'm not sure why I'm so unsettled. The doldrums may wear off by tomorrow, though I'm not counting on it. Regardless, I'll return in 24 hours with another fractal, and if I have no philosophy, I'll have at least a few words about the fractal. Until then, take care, and be of good cheer. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Heliosphere { ; time=0:14:13.55 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+0.4654990346770224/-3.884180985250454/61\ 65647/1/29.999 params=15/-1.15/1/-11.5/-2/500 float=y maxiter=3600 inside=0 logmap=227 periodicity=10 colors=000000000000<3>0000000000000000000200400840AA\ 0EE2GH6JNALREPXHR`LVdPXiT`mVboL`qPZr<2>`RudPqgRokVko\ Xgs`dvb`zc_<3>ohWliVijU<2>`mR<2>PsXLuZHvZEx`Azb6zd2z\ e0zg0zi0zk0zk0zg0ze0zd4zb8z`CxX<2>PsRTqPXoL<3>kgEdeC\ ZdARbAL`8EZ68X60V40T20R20T00V00X04X08Z0C`0E`0GV6HPGH\ LPJG`LAiL6sN0zP0zP0zV0z<3>i0zm0zq0xu0ux0qz0mz0iz0ez0\ bz0`<2>z0kv6oqGskNvgXzbdzXmzTuzNzzHzzEzzGzzHzzHzzJzz\ JuzLqvLksNgoNdkCTe0Jb08Z00V0CP8NLNZHbkEqvAzz6zzEzzJz\ zPzzXzzbzzgzzozwuzszzmzzmzzAzzAzxAzsismmigs`bxTXzJRz\ ALz2Gz0Az0Cz0Ez0Ez6GzCGzJHzPHzXJzbJziLzoLzuZiviNvv0x\ z0xz0qx0iu0b<3>dV8`b0Xi0Tq0Px0Lz0Nz0Pz0Pz0Rz0Tz0Tz0V\ z0Vz0Pz4JzCGzLAzT6zb0zi0zs0zz<2>0zz0zz0zx<2>0zN6zJEz\ HLzGTzE`zA<2>vz4zzzqzzgzzZzoPzd<2>0z60z0<2>0z00z60zN\ 4zdLzNbz8dzA<4>mzAozAqzC0zA0z8 } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) Re: C-FOTD 23-11-00 Date: 24 Nov 2000 17:23:54 -0500 (EST) At 11:24 AM 11/23/00 -0000, Andrew Coppin wrote: >Wow! Now *that* is what I call a colour scheme. Fantastic! Jim, you >are an inspiration to us all! I'm glad you enjoyed my modest effort. It's too bad that my literary inspiration is currently lagging so far behind my fractal luck. But I've had these fallow periods before. They always pass eventually. C-FOTD to follow in a few hours. Until then, take care, and do we find fractals or create them? Jim M. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: C-FOTD 23-11-00 Date: 25 Nov 2000 05:49:09 -0500 >Wow! Now *that* is what I call a colour scheme. Fantastic! Jim, you >are an inspiration to us all! Seconded. _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: LeeRLane@cs.com Subject: (fractint) 3-D pars Date: 25 Nov 2000 16:35:54 EST One of my favorite aspects of Fractint 20.0 is its option of making 3-D images, stereo pairs and random dot stereograms. Unfortunately, I have not found a way to make parameter files of them. A couple years ago, Les Sinclair posted to the List some 3-D transforms by using pairs of pars, but even that option seems to be unavailable to stereo pairs and stereograms. Can someone help? Lee Lane Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 26-11-00 (Study Number One [5]) Date: 25 Nov 2000 21:34:46 -0500 (EST) Classic FOTD -- November 26, 2000 (Rating 5) Fractal visionaries and enthusiasts: At first glance, the formula Z+1/Z+1/C would not appear to have much potential for creating fractals. But as today's image shows, in the world of fractals, things are not always as they would appear. The formula actually creates quite an unusual fractal, filled with midgets surrounded by caterpillar-like spirals. Unable to think of an alternate name for today's fractal, and not wanting to name it "Caterpillars", I gave it the technical name "Study-01", which like "Symphony in E flat major" is nothing more than a description by which the work may be indexed. The rating of 5 reasonably represents this average- quality fractal. The 5-1/2 minute render time is a bit slow. The cure is to download the file of the already-rendered GIF image from: or from: The fractal weather today was cloudy and cold. At nightfall a steady light rain set in, which is still continuing. The day was unpleasant enough for humans; for fractal cats it was unbearable. The cats passed the day sprawled by the warmest radiators they could find. And I'm going to pass the rest of the evening in my traditional Saturday evening routine -- watching a junky old sci-fi or horror movie on TV. I shall return tomorrow. Until then, take care, and if the universe is a great accident, who or what had the accident? Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Study_Number_One { ; time=0:05:39.33 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+0.26049780581950650/-0.00067297120701050\ /3.805436e+007/1/169.999 params=1/1/1/-1/-2.5/200 float=y maxiter=1400 inside=0 logmap=78 periodicity=9 colors=0000BC<2>0D70E60F30G1<3>0K00L00M0<2>1P0<3>KS0\ MS0RT0VV0_V0aW0fW0jY1n_3q_4v`6z`7za9zd6<2>zYFzVIxTLv\ RO<2>nKinIpmIwqOzwTzzfzz_zvSzpLwjDpd6ia7a_9WY9VVATTA\ SRCSOCRMDPKDOIFMHFMHHMIHMIHMKHMLHTPHTVHVWHVYH__HV_HS\ _HP_HMYIIYKFYKCYL9YM4YO1YP0YP0`R1cS7fSCiTIkVMnVSqWWt\ WawYfz_kz_pz`vzYzz`z<3>zfszap<2>zPkzLizIgzDfz9dx4aw0\ `v0_t0Y<5>t0ft0gt0it0jt0kt0mt0m<3>t0st0tt0vt0wt0xt0z\ <2>t0zp0zk4zgAxdFx`LwWPvSVtP_tLdsHiqCnp9sp4xn0zm0zn0\ zm0zk<2>0zi0zi1zg1zg1zf3zd3zd4zc4zc6za<2>7z_7z_9zY9z\ W<2>AzVHzTLzSPwRTsPVnO<2>VaKVfH<2>_sC`wAaz9cz1dx0<3>\ jv0kx1mzC<3>szptzzvzzwzzxzzzzwzzszxn<2>znazkYziTzdPz\ aLz_HzWCzT7zV4zi7zw9zzCzzD<3>zzCzzCzwC<3>zkCziCzfCzg\ FzgHziKziLziO<2>zjTzkVzkYzk_zmazmczmdzkfzjgziiziizii } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Karl Simanonok Subject: (fractint) Universe Date: 25 Nov 2000 23:29:15 -0800 Hi Jim, This is a really great quote. Are you the originator, or is it someone else's? Regards, Karl S. At 09:34 PM 11/25/2000 -0500, you wrote: >if the universe is a great accident, who or what had the accident? Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) Re: Universe Date: 26 Nov 2000 12:46:46 EST I wrote in the FOTD of 26-11-00 Karl replied: << Hi Jim, This is a really great quote. Are you the originator, or is it someone else's? Regards, Karl S. >> The quote is original with me. I thought of the quote about 10 seconds before I wrote it. But I do a lot of reading about such topics, and I could have picked it up from some forgotten source. Jim M. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 27-11-00 (Square Roof of Two [5]) Date: 27 Nov 2000 00:22:51 -0500 (EST) Classic FOTD -- November 27, 2000 (Rating 5) Fractal visionaries and enthusiasts: Today's C-FOTD is named "Square Root of Two". The reason is that the exponent of Z is sqrt(2). I rated the picture a 5 because I doubt that it is worth any more than that. To add to the interest, I calculated a part of the image far out in a negative direction on the infinite spiral of the complex logarithm. The value of -1234567890 that I entered is totally whimsical, and why not? Doing things on a whim is great fun. Though midgets of order 1.414... are hard to find, the search, as today's image illustrates, can be worth the effort. The draw time of the parameter file is a slow 11-3/4 minutes; the down- load time is far shorter. Look for the download on Usenet at: and in an hour or so on Usenet at: The fractal weather today here at Fractal H.Q. was cloudy in the morning, with intermittent heavy showers, followed by clearing in the afternoon. The temperature of 56 brought out the cats, though the wet grass dampened their adventurous spirits. And I, having my spirit dampened by world events, am ready to shut down the fractal shoppe and declare the day closed. Until tomorrow, take care, and then take even more care. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Square_Root_of_Two { ; time=0:11:47.44 -- SF5 on a P200 reset=2001 type=formula formulafile=branchct.frm formulaname=MandelbrotBC passes=1 center-mag=+0.7234134339563163/-0.1756656620377885/6\ 71159.7/1/-22.5 params=1.414213562373/0/-1234567890/0 float=y maxiter=50000 inside=0 periodicity=10 colors=0004Ag38k28n07r07v06y06z04z04zSBizHKzHI<2>zI8\ zNHzSOyYXwabaaE_bBZcAXe7Vf4Ug3Qf7NeAJeDHcH<2>7bOBaRF\ aUJ_XM_ZQZaUZcXYf_YicXkgXnjVqnVsrUvuUyySzzSzzSznIzZ7\ uJ0oK4j<2>KOYKVUMbOMiKMoHMvBMz7Mz3Nz8NrEOiJOaOQSU<2>\ R3gF2U30H84KD7OIASMDXRF_VIc_KgcOjiRn<2>vZzzazzczzfzz\ gzvgzogwigsbgoXij<3>6iVAgX<4>NfbQfcSfeVffYffaeg<2>ie\ kkemncnqcoscqvcrycrzeszeu<2>zfvzfwzgy<2>zgzzkyzoyzrw\ zvwzzwzzvzzvzzvzzszzqzznzzmzyjzvgzufzrczqaznZzmYzjVz\ iSzfRzeOzbMzaJzZIzYFzVDzVA<2>zUBvSBsSBoSBmRBiRBfRBbR\ BZQDXQDSQDQODMODJODFNDDND8ND07H6NDHaARo7ez0az4YwAVrF\ RkMOfRK_XIVaEOg<2>47w84yD2yH0yK0yO0zN0yN0vN0sN0qN0mN\ 0jN0gN0eN0aN0ZN0X<2>N0NN0KN0IN0E<3>N03K07J3BI7EHAIFE\ KEHODJS<2>8Ua7Xe6ZgAagDbgFcgIfgMggOigRkgUmgYng_qgbrg\ esgbzigugenZkefqXnJFHIEJHENEDRDDUBBY8Ba7Ac } frm:MandelbrotBC = { ; Z = Z^E + C e=p1 p=real(p2)+PI q=2*PI*trunc(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z|<100 } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: (fractint) C-FOTDs Date: 27 Nov 2000 10:29:09 -0000 Te he... The Square Roof of 2? ^ Erm, sorry for my stupidity, but wouldn't Z+1/Z+1 = 1? In that case, Z+1/Z+1/C reduced to 1/C. Or is the entire fractal the result of some internal artifact of FractInt's parser logic or something? Maybe I'm just dense... BTW, I've come up with a formula that does something very strange. I was working on the formula Z = Z^3 - 3(A^2)Z + B, which is apparently the generalized form of the cubic equation. (OK, whatever.) Anyway, drawing Julias is fine, but drawing the Mandelbrot set poses a problem. The formula has two critical points to iterate: +A and -A. The Mandelbrot set is the intersection of the two sets generated by iteration these two start points. Fine, I thought. I'll have two iteration variables. Anyway, the formula works, but it does something I've never seen before. With the right colour scheme (bud1.map), for certain parameters you get a scene involving a very mangled pair of Mandelbrot sets. Closer inspection reveals that parts of the lace-like structures that radiate out from all Mandeloids is "missing". But there is still a very faint "shaddow" of the fronds. Very spooky. I don't have the formula with me right now, but as soon as I can I'll post pars. (The other interesting thing is that you get well-formed Mandelbrots that are disconnected.) Andrew. _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Lee Skinner Subject: (fractint) C-FOTDs Date: 27 Nov 2000 07:13:13 -0500 I'd love to see those pars, Andrew. Here's one for you (slow, but worth it!) 61124009 { ; t=3D 5:03:0= 3.47 ; on a P233 at 1600x1200 Nov 27, 2000 05:07:51 ; Image Copyright 2000 by Lee H. Skinner ver=3D2001 ; Version 2001 Patchlevel 3 reset=3D2001 type=3Dformula formulafile=3Dfractint.frm formulaname=3Dmandelbrotmix4 function=3Drecip passes=3D1 center-mag=3D+2.71707619839821900/-0.94866867868312280/5936.513/1/-122.= 5 params=3D15/-1.15/1/-11.5/-2/500 float=3Dy maxiter=3D3600 inside=3D0 logmap=3D231 symmetry=3Dnone periodicity=3D9 colors=3D000Mg2Mg2Lh1<40>ul1vl1wl1xl1yl1zm0<29>zF0zE0zD0<2>zA0z80z82<13= >z4\ bz3ez3g<3>z2r<3>zmxzzzruz<3>N`zFWz6Qz<3>SLmYKicJf<3>pKcsKbvKazL`<6>zQPz= R\ NzRL<3>zUD<3>nI9jF8gC6<3>V01<2>yB3<14>yfAyhByjB<2>ypDysEytF<2>zwHzwIzvK= <\ 3>zuQ<3>cvnYwuXvu<4>OpvNnvLmw<3>Ehx<3>8Th7Pd5L`<2>08P<3>9IJBLHDNG<3>NY9= <\ 30>Mg2 } Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: Re: (fractint) C-FOTDs Date: 27 Nov 2000 15:33:32 -0000 >From: Lee Skinner >Reply-To: fractint@lists.xmission.com >To: fractint@lists.xmission.com >Subject: (fractint) C-FOTDs >Date: Mon, 27 Nov 2000 07:13:13 -0500 > >I'd love to see those pars, Andrew. Here's one for you (slow, but worth >it!) > >61124009 Well, I've typed the formula back in from memory here at uni (I did the origanol at home). And the map wasn't bud1.map, in fact I can't remember what is was at all. But the .par below shows a good approximation of what I had... ---BEGIN CUBIC.FRM--- CubicJulia { ; By Andrew Coppin, orphi69@hotmail.com A = p1 B = p2 Z = Pixel T = 3*Sqr(A): Z = Z*Z*Z - T*Z + B |Z| < 4 } CubicMandelUnion { ; By Andrew Coppin, orphi69@hotmail.com ; If real(p1) = 0, draw B-plane, else A-plane. IF(real(p1)>0) A = Pixel B = p2 ELSE A = p2 B = Pixel ENDIF ZP = A ZM = -A T = 3*Sqr(A): ZP = ZP*ZP*ZP - T*ZP + B ZM = ZM*ZM*ZM - T*ZM + B IF(|ZP|>|ZM|) Z = ZP ELSE Z = ZM ENDIF |Z| < 4 } ---END CUBIC.FRM--- ---BEGIN CUBIC.PAR--- Shaddows { ; Weird... reset=2000 type=formula formulafile=cubic.frm formulaname=CubicMandelUnion passes=g center-mag=-0.61165285379202610/+0.15953079178885670/32.96414 params=1/0/0.5/0 float=y maxiter=4096 inside=255 colors=mob<9>YjdXidVhdUhdSgdQfe<3>NcbNbaMa`L`_<7>BNMALL8JJ7IH<3>3CB2AA29\ 9<2>366356245234235236<3>22D31F42H42J53M64P<10>L3iM3kN3m<3>T2uU1vV1xX0z<\ 9>TJzSKzSMzROzRQzQSz<9>YYtYZtZ_s<2>aaqbbpddr<3>llz<3>hasgZqeWo<10>ZFbYD`\ YB_XAZW8YV6W<12>I2JH1IG1H<2>D0DC0CB1B<3>727626255244333222<2>414515717<2\ >B0DC0FC0H<3>G0PH0RH0S<8>K0fL0hL0j<2>M0oN0qN0q<7>S7tT8tT8uU9uVAuVBv<10>k\ IelJcnJaoK`qLZsMX<3>rQWrSVrTV<2>rYUrZUr`VraVrcVrdVqfW<3>qkbqmdqnfqphqqjp\ sl<4>oqf000kkk } ---END CUBIC.PAR--- I have a feeling Hotmail is going to word-wrap that. Oh well. It renders at 1280x1024 in under 10 minuites, so it's not that slow in the grand scheme of things. You'll notice it sets params=1/0/0.5/0. That means "draw the A-Plane, with B=0.5+0i". I've done a little zoom in. But everywhere you look you find shaddows. Very strange effect. If anyone comes up with any good .pars for this formula, let me know!!! _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: Re: (fractint) C-FOTDs Date: 27 Nov 2000 15:44:37 -0000 >From: Lee Skinner >Reply-To: fractint@lists.xmission.com >To: fractint@lists.xmission.com >Subject: (fractint) C-FOTDs >Date: Mon, 27 Nov 2000 07:13:13 -0500 > >I'd love to see those pars, Andrew. Here's one for you (slow, but worth >it!) > >61124009 { ; t= 5:03:03.47 > ; on a P233 at 1600x1200 Nov 27, 2000 05:07:51 > ; Image Copyright 2000 by Lee H. Skinner ver=2001 > ; Version 2001 Patchlevel 3 > reset=2001 type=formula formulafile=fractint.frm > formulaname=mandelbrotmix4 function=recip passes=1 > center-mag=+2.71707619839821900/-0.94866867868312280/5936.513/1/-122.5 > params=15/-1.15/1/-11.5/-2/500 float=y maxiter=3600 inside=0 > logmap=231 symmetry=none periodicity=9 formulafile=fractint.frm formulaname=mandelbrotmix4 Not on my system! Oh well, I'll have to wait for Jim's next C-FOTD, in which he will inevatably repost that formula. (Well... maybe he'll just my MandelbrotBC formula instead... or maybe even CubicMandelUnion! I can dream can't I?...) _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 28-11-00 (Spooky Radicals [4]) Date: 27 Nov 2000 20:48:48 -0500 (EST) Classic FOTD -- November 28, 2000 (Rating 4) Fractal visionaries and enthusiasts: Does two have a square roof? According to yesterday's C-FOTD it does. It also has a square root, but then so does a tree growing in a square pot. But regardless of whether the roof or root is square, the image is the same. This morning's letter from Andrew Coppin that mentions the square roof also mentions spooky things that sometimes happen in the world of fractals, where ghosts of things that no longer exist are sometimes visible. I can't comment on the fractal that Andrew was referring to because I have not seen it, but I have done lots of experimenting with fractal ghosts in my 13 years of fractaling. These ghosts are quite common, needing only the proper color scheme to make them evident. They exist in all planes and all orientations of four-dimensional Julibrots except the Julia sets. Today's picture shows some very obvious ghost-buds in one of the perturbed Mandelbrot sets. The ghosts are indeed shadows of things that exist in other planes. In today's picture, the brilliant bud-like outlines in the background are shadows of the buds that exist at the same coordinates in the unperturbed Mandelbrot set. To see the buds unobscured, simply change the Z parameters of today's image to 0,0. The reason the ghosts exist can be explained by the geometry of the four-dimensional Julibrot. I'll not go into the involved explanation at this time, other than to say that the Mandelbrot shape exists as an interrupted 4-D hypercylinder in the Julibrot. The coloring of today's image was done with the under-utilized ranges and banding features of Fractint. A total of only 13 colors are used in the image, though the impression is one of far more colors. I named the picture "Spooky Radicals" after the ghost-like outlines of the buds. (A radical consists of a bud plus all its associated filaments and midgets.) I rated the picture a 4, which may be a bit modest. With a render time of just under 5 minutes, running the parameter file risks impatience. The remedy is to download the GIF image file from: or from: The fractal weather today was partly sunny, with a temperature of 57F (14C), which was mild enough for the fractal cats to enjoy several hours out of doors. The philosophy is still stifled by the ridiculous political situation here in the U.S., which is giving me no end of frustration. I suppose we'll have no philosophy until we have a president. Right now, I'm going to ignore a couple pressing tasks and have myself an enjoyable evening before the TV. I'll return tomorrow with fractal and blather. Until then, take care, but not so much care that it stops being fun. Jim Muth jamth@mindspring.com START 20.0 PARAMETER FILE================================== Spooky_Radicals { ; time=0:04:44.18 -- SF5 on a P200 reset=2000 type=mandel passes=1 center-mag=-0.20959612173315630/+0.64448795330341930\ /817.6347/1/-7.499 params=0.75/-0.45 float=y maxiter=32767 inside=13 logmap=46 periodicity=10 ranges=0/-1/240/250/270/310/390/640/990/1400/2500/50\ 00/32767 sound=off colors=000K00YPQUK5<4>UhUUmZUrccwmhzzOKX000<240>000 } END 20.0 PARAMETER FILE==================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: Re: (fractint) C-FOTD 28-11-00 (Spooky Radicals [4]) Date: 28 Nov 2000 11:02:13 -0000 >From: Jim Muth >Reply-To: fractint@lists.xmission.com >To: fractint@lists.xmission.com >CC: philofractal@lists.fractalus.com >Subject: (fractint) C-FOTD 28-11-00 (Spooky Radicals [4]) >Date: Mon, 27 Nov 2000 20:48:48 -0500 (EST) > > >Classic FOTD -- November 28, 2000 (Rating 4) >This morning's letter from Andrew Coppin that mentions the >square roof also mentions spooky things that sometimes happen in >the world of fractals, where ghosts of things that no longer >exist are sometimes visible. I can't comment on the fractal >that Andrew was referring to because I have not seen it, but I >have done lots of experimenting with fractal ghosts in my 13 >years of fractaling. Jeepers creepers! Now *that* is one unusual image! Nice one! If you (or anyone else) wants to see the image I mentioned without fiddling around with the .par I posted, fire up your fav. browser and type http://lyta.mk.dmu.ac.uk/~khcm8ac/DWeb/Assign/FI20/Shaddows.gif This will show you a 1280x1024 GIF of the image that got me so excited. I really have no idea how it works (the single-orbit version shows no such shaddows, so it's not a feature of the cubic formula, it must be my dual-orbit logic). The further I zoom, the more interesting stuff I find. Now here's a challenge: I have yet to find any midgets within this image. Can Jim or anyone else do so? (Without changing the parameters from param=1/0/0.5/0!) Can I do it first? We shall see... Let's race! Andrew. _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-11-00 (Spooky Radicals [4]) Date: 28 Nov 2000 07:58:01 -0500 Funky. I've seen this kind of thing before with formulas that combine multiple critical points. It's normal, but cool. _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) Re: C-FOTD 28-11-00 Date: 28 Nov 2000 08:58:17 -0500 (EST) At 11:02 AM 11/28/00 -0000, Andrew Coppin wrote: >Now here's a challenge: I have yet to find any midgets within this image. [found at] >Can Jim or anyone else do so? (Without changing the parameters from >param=1/0/0.5/0!) Can I do it first? We shall see... > >Let's race! The race would be futile unless the parameters are changed. The present parameters draw a fractal with perturbed Mandelbrot features, and such fractals do not contain intact Mandelbrot midgets. Jim M. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: Re: (fractint) Re: C-FOTD 28-11-00 Date: 28 Nov 2000 14:07:45 -0000 >From: Jim Muth >Reply-To: fractint@lists.xmission.com >To: fractint@lists.xmission.com >Subject: (fractint) Re: C-FOTD 28-11-00 >Date: Tue, 28 Nov 2000 08:58:17 -0500 (EST) > >At 11:02 AM 11/28/00 -0000, Andrew Coppin wrote: > > > >Now here's a challenge: I have yet to find any midgets within this image. > [found at] > > > > >Can Jim or anyone else do so? (Without changing the parameters from > >param=1/0/0.5/0!) Can I do it first? We shall see... > > > >Let's race! > >The race would be futile unless the parameters are changed. The present >parameters draw a fractal with perturbed Mandelbrot features, and such >fractals do not contain intact Mandelbrot midgets. > >Jim M. Fantastic. I'm beaten before the race even starts! I wonder... the B-plane seems to draw more intact features... maybe I can find something here. BTW. I have found an almost-intact midget in with the parameters above. It has the classic cardiod body and the period 2 bud with its negative tail, but the sides are missing! As a matter of interest, BOF recons that all quadratic fractals are equivalent to the classic Z^2 + C by a change of variables, and that all cubics are equivalent to the formula I used (Z^3 - 3(A^2) + B). I don't get it. Does anyone else? _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mike Traynor Subject: Re: (fractint) C-FOTDs Date: 28 Nov 2000 15:21:21 -0500 Andrew, > CubicJulia { ; By Andrew Coppin, orphi69@hotmail.com > A = p1 > B = p2 > Z = Pixel > T = 3*Sqr(A): > Z = Z*Z*Z - T*Z + B > |Z| < 4 > } I already have a similar formula called CubicJulia in my orgform collection (not my formula, in case that is not clear). Is the formula above supposed to differ, or is it a product of your being at uni and not home when you posted? Here it is: CubicJulia { A = p1 B = p2 T = 3*A*A Z = Pixel: Z = Z*Z*Z - T*Z + B |Z| < 4 ;SOURCE: 99msg.frm } Mike Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Tim Wegner Subject: (fractint) linux/X's 24bit pixels Date: 28 Nov 2000 16:47:10 -0600 Note: the author tried to post this to the fractint list, but couldn't because he is not a member, so I posted it. Tim From mlarch@ix.netcom.com Tue Nov 28 06:59:16 2000 Message-ID: MIME-Version: 1.0 Content-Type: TEXT/PLAIN; charset=US-ASCII I have rudely and naively hacked up xfractint-3.10 and hard-wired it for 24bit colored pixels under Linux/X3.3.6. It is a mess, not suited for distribution in any respect. No fancy color hacks or anything and there are lots of, um, issues, outstanding. Is there any interest in this? It is still buggy to be sure, but, more or less, at least it is color (heres' a png screenshot. It shows Xfractint with that wonderful ;-) vga dac color map and also shows some compression-distorted xwininfo info (235k): http://members.nbci.com/mlarch/xfractint-screenshot.png ). I don't know what the state of things are with fractint and Linux and X, I'm way way out of the loop, someone else may have done (probably did do) this long long ago. Whatever. If your interested there is a a tar.gz at http://members.nbci.com/mlarch/xf-hacks.tar.gz (104k) P.S. I am not on the fractint mailing list so if you wish to contact me use: mailto://mlarch@ix.netcom.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 29-11-00 (The Minibrot Blues [6]) Date: 28 Nov 2000 18:58:06 -0500 (EST) Classic FOTD -- November 29, 2000 (Rating 6) Fractal visionaries and enthusiasts: On some days I just can't find a fractal. Those days give me the minibrot blues, which just happens to be the name I attached to today's C-FOTD. The image, with its somber blues and purples, effectively captures the mood I feel when unable to find my Classic Fractal of the Day. After studying the picture for all of 2 minutes, I rated it a 6, which is 2 points higher than yesterday's spooky C-FOTD. Actually, I would have rated yesterday's image 3 or 4 points higher, had I not already done so many of this type of image over the years. The fractal formula 2Z^(-1.2)+0.4Z^(-12)+(1/C) was iterated by M-Mix4 to create today's image. The render time of the attached parameter file is around 8 minutes on a 200mhz Pentium machine, making it quicker to download the GIF image from: or: For all who are interested, the weather today at Fractal Central was partly sunny and 56F (13C) -- conditions the fractal cats approved of. They showed their approval by passing the afternoon lounging in the off-and-on sun. When the sun went behind the hemlock tree, they came indoors for their meal. That's it for now. I'll be back in 24 or so hours with more fractal surprises. Until then, take care, and be surprised. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ The_Minibrot_Blues { ; time=0:07:44.42 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+14.81958856094954000/+10.489897672886060\ 00/1.672409e+007/1/177.499 params=2/-1.2/0.4/-12/0/0 float=y maxiter=1350 inside=0 logmap=151 periodicity=9 colors=000CIWGIZKI`NKbSIfVGhZEjaBmf9pi7sm4up3wp8y<2>\ pMzmLvjKnhIefHYbGO`FGZE7WC0VC1UC3TC6SC8QC9PCCOCGNCKM\ CNLCQKCU<3>FCgECjCCnBCqACu9Cx8Cz8Cz<3>E7eF6_G4UH3OI2\ IH3CG3C<2>E3GE3HC4K<3>94O94P86S76T76U66V46W46Y37_27`\ <2>0Ec0Ge2Ig<3>ASkBUmEWoGZpH`qKbsMetN_uPUpQOkTKg<3>Z\ LP`LLaLGcLBeL7fL2gN4hO7iQ8iSAjUBkVEmWFmZHn_IoaLpbMpe\ OqfPsgStiTtjVumWvnZvo_qmamjbiheeff`cgYaiT_jOYmLVnGTo\ BQq8Os3Mu0Kv0Hw0Is3Kn<3>INWMOSQONUPIYQE`Q9cTAgVBjWBn\ ZCp_CtaEwbEzeF<2>zhGziGyjGxkG<3>vpHuqHtsHttHsuHqvHqw\ HpxK<2>pxNpxPpzQpyQ<6>pz`pzapzbpzcpzfpzgpzhvK0<4>uN2\ uO3uO4uP4uQ6uQ6uS7<6>tWBtWCtYCtYE<5>taIsaIsbKsbKscLs\ eM<3>sgOsgOshPsiQsiQsjSqjSqkTqkUqmUqmVqnVqoWqoY<2>qq\ Zqq_qs`<3>pubpvcpve<2>pwe } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: Re: (fractint) Re: C-FOTD 28-11-00 Date: 29 Nov 2000 19:51:45 +1300 At 14:07 28/11/2000 +0000, Andrew Coppin asked: >As a matter of interest, BOF recons that all quadratic fractals are >equivalent to the classic Z^2 + C by a change of variables, and that all >cubics are equivalent to the formula I used (Z^3 - 3(A^2)Z + B). I don't >get it. Does anyone else? It's a little more elaborate than necessary, in fact. z^3+az+b will do just fine. Let's start with a pretty general cubic formula: z^3+az^2+bz+c If the coefficient of z^3 had been anything other than 1 we could have divided by it without affecting any of the cubic's features. We're safe in dividing, because if said coefficient had been zero, it wouldn't have been a cubic in the first place. Now, the "change of variables" bit. We replace z with w-a/3. This shifts the coordinate axes a bit (in two dimensions drawn in the conventional manner, it slides the horizontal axis up and down). But it doesn't distort the cubic itself. So when you're done you can substitute w=z+a/3 back into the result to shift the axes back to where they were. (This is the just the same sort of argument as I used when justifying my division). So, what happens when we replace z with w-a/3? Well, here we go: watch in particular what happens to the square term. Keep your eye on the ball. (w-a/3)^3+a(w-a/3)^2+b(w-a/3)+c = w^3-(a^2/3+b)w+2a^3/27-ab/3+c ...and it disappears in a puff of algebra. If I used Q to represent -(a^2/3+b) and P for 2a^3/27-ab/3+c this would be w^3+Qw+P Which is a lot more compact. It's not instantly clear to me why BoF has the more elaborate version; perhaps fiddling with the parameters in both versions to see what they do will suggest something. Beginning of digression. If I can stick with real arithmetic for a moment, you could represent every possible cubic by a single point on the Q-P plane, coloured, say, on the basis of the number of points where its derivative is zero. You'll get a sort of inside-out-parabola cum curved-V shape in one colour; with the space between the arms a second colour, and the rest a third. This shape is known in catastrophe theory as a "cusp". End of digression. The quadratic z^2+az+b I leave as an exercise for the reader. Morgan L. Owens "'Bout time I let someone else answer these sorts of questions!" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 30-11-00 (A Riot of Colors [6]) Date: 29 Nov 2000 23:54:42 -0500 (EST) Classic FOTD -- November 30, 2000 (Rating 6) Fractal visionaries and enthusiasts: I have rarely seen a fractal so filled with colors. If anything, the name "A Riot of Colors" is an understatement, the effect of the image being one of carnival and merriment. All in all it is quite a contrast to yesterday's depressing image, though both images rate a slightly above average 6. The expression 0.53(1/(Z^2)-2Z)+(1/C), which drew the image, may appear random, but the factors are actually quite critical. The render time of the parameter file is a slow 15+ minutes -- slow enough to cause an irresistible urge to download the GIF image file from: or from: The fractal weather today was increasingly cloudy with a temperature of 52F (11C), which was marginal for the cats outdoor adventure. At nightfall a cold rain accompanied by a little thunder moved in, bringing the day to an inauspicious close. But it's now time to bring my day to an auspicious close. Until tomorrow at this same time and place, when I plan a trip into the fourth dimension, take care, and see you then. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ A_Riot_of_Colors { ; time=0:15:14.13 -- SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+0.05093424425905903/+0.21086081060670720\ /3504462/1/-92.5 params=1/-2/-2/1/-0.47/0 float=y maxiter=3300 inside=0 logmap=232 periodicity=10 colors=0003fA3eA<2>y2h<3>oDcmGajI`hL_fNZ<3>oZNqaLsdI\ <2>ymA<9>epAcpAapA<3>VqA<3>`aHaYIbUKdQLeMNfJOjCPn5P<\ 5>UJFRMDNOB<3>AX5<8>AkEAlFAnG<3>AtK<3>agv<4>dPbeMZeI\ V<3>g4G<3>WAMTCOQDPNFRLGS<3>zco<4>oacmaal`_<3>d_Rb_P\ a_N<6>ZRZYQ`YOb<3>XKh<2>rtj<8>NPLJMJGIG<3>255<2>mcb<\ 3>ShZMjYHkXBlW6mV<3>dRNlMLkQN<4>geTfiVelW<2>bv_by``v\ _<6>RaVPZVOWU<3>ILS<6>``MbbLeeL<3>omI<3>hrIftIduIbvI\ awIdxLfyO<3>nzYpz`rzc<2>xzj<3>_zRUzMOzHIzD<2>Xzj<3>N\ zSKzNIzJ<2>Czp<3>NzqPzqSzq<3>azr6zA<3>4zA } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: Re: (fractint) C-FOTD 30-11-00 (A Riot of Colors [6]) Date: 30 Nov 2000 10:32:04 -0000 >From: Jim Muth >Reply-To: fractint@lists.xmission.com >To: fractint@lists.xmission.com >CC: philofractal@lists.fractalus.com >Subject: (fractint) C-FOTD 30-11-00 (A Riot of Colors [6]) >Date: Wed, 29 Nov 2000 23:54:42 -0500 (EST) > > >Classic FOTD -- November 30, 2000 (Rating 6) I'm sorry, but I'd rate this one more like 7 or even 8! It looks *trippy*! If only *I* could come up with colours like that... _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: Re: (fractint) C-FOTDs Date: 30 Nov 2000 10:34:07 -0000 A few moments comparisom proves that they are indeed identical (except that the OrgForm version uses T = 3*A*A, whereas I use T = 3*Sqr(A), so one may theoretically be faster - not sure which though!) >From: Mike Traynor >Reply-To: fractint@lists.xmission.com >To: fractint@lists.xmission.com >Subject: Re: (fractint) C-FOTDs >Date: Tue, 28 Nov 2000 15:21:21 -0500 > >Andrew, > > > CubicJulia { ; By Andrew Coppin, orphi69@hotmail.com > > A = p1 > > B = p2 > > Z = Pixel > > T = 3*Sqr(A): > > Z = Z*Z*Z - T*Z + B > > |Z| < 4 > > } > >I already have a similar formula called CubicJulia in my orgform collection >(not my formula, in >case that is not clear). Is the formula above supposed to differ, or is it >a product of your >being at uni and not home when you posted? Here it is: > >CubicJulia { > A = p1 > B = p2 > T = 3*A*A > Z = Pixel: > Z = Z*Z*Z - T*Z + B > |Z| < 4 > ;SOURCE: 99msg.frm >} > > >Mike > >-------------------------------------------------------------- >Thanks for using Fractint, The Fractals and Fractint Discussion List >Post Message: fractint@lists.xmission.com >Get Commands: majordomo@lists.xmission.com "help" >Administrator: twegner@fractint.org >Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: Re: (fractint) Re: C-FOTD 28-11-00 Date: 30 Nov 2000 10:41:07 -0000 >From: "Morgan L. Owens" >Reply-To: fractint@lists.xmission.com >To: fractint@lists.xmission.com >Subject: Re: (fractint) Re: C-FOTD 28-11-00 >Date: Wed, 29 Nov 2000 19:51:45 +1300 > >At 14:07 28/11/2000 +0000, Andrew Coppin asked: >>As a matter of interest, BOF recons that all quadratic fractals are >>equivalent to the classic Z^2 + C by a change of variables, and that all >>cubics are equivalent to the formula I used (Z^3 - 3(A^2)Z + B). I don't >>get it. Does anyone else? > >It's a little more elaborate than necessary, in fact. z^3+az+b will do just >fine. I've tried that. It seems to draw a different image in Mandelbrot mode, though the Julia sets are still the same (if you change parameters). >Let's start with a pretty general cubic formula: > >z^3+az^2+bz+c > >If the coefficient of z^3 had been anything other than 1 we could have >divided by it without affecting any of the cubic's features. We're safe in >dividing, because if said coefficient had been zero, it wouldn't have been >a cubic in the first place. Figures. >Now, the "change of variables" bit. We replace z with w-a/3. This shifts >the coordinate axes a bit (in two dimensions drawn in the conventional >manner, it slides the horizontal axis up and down). But it doesn't distort >the cubic itself. So when you're done you can substitute w=z+a/3 back into >the result to shift the axes back to where they were. (This is the just the >same sort of argument as I used when justifying my division). Fine. >So, what happens when we replace z with w-a/3? Well, here we go: watch in >particular what happens to the square term. Keep your eye on the ball. > >(w-a/3)^3+a(w-a/3)^2+b(w-a/3)+c >= >w^3-(a^2/3+b)w+2a^3/27-ab/3+c > >...and it disappears in a puff of algebra. OK, I'm going to have to spend half an hour crawling through that is super-slo-mo, but I believe you. >If I used Q to represent >-(a^2/3+b) and P for 2a^3/27-ab/3+c this would be > >w^3+Qw+P > >Which is a lot more compact. It's not instantly clear to me why BoF has the >more elaborate version; perhaps fiddling with the parameters in both >versions to see what they do will suggest something. Like I said, the no difference in the Julia sets (except that you use different A/B to get the same image depending on which formula you use). But the Mandelbrot images (in the A-plane or any B-Plane where A<>0) are definitly different. The BoF version gives less "mangled" looking images. IDK Y. >Beginning of digression. If I can stick with real arithmetic for a moment, >you could represent every possible cubic by a single point on the Q-P >plane, coloured, say, on the basis of the number of points where its >derivative is zero. You'll get a sort of inside-out-parabola cum curved-V >shape in one colour; with the space between the arms a second colour, and >the rest a third. This shape is known in catastrophe theory as a "cusp". >End of digression. > > >The quadratic z^2+az+b I leave as an exercise for the reader. Never mind that... I'm gonna attempt the quartic! (Prepair to hear confirmation of my failure any time soon!) >Morgan L. Owens >"'Bout time I let someone else answer these sorts of questions!" Does any one else out there know/care how to answer? Andrew. "You wouldn't believe the amount of code I wrote to make a JavaScript complex number calculator!" _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: Re: (fractint) C-FOTDs Date: 30 Nov 2000 10:53:33 -0000 >From: "Andrew Coppin" >Reply-To: fractint@lists.xmission.com >To: fractint@lists.xmission.com >Subject: Re: (fractint) C-FOTDs >Date: Mon, 27 Nov 2000 15:44:37 -0000 > >>From: Lee Skinner >>Reply-To: fractint@lists.xmission.com >>To: fractint@lists.xmission.com >>Subject: (fractint) C-FOTDs >>Date: Mon, 27 Nov 2000 07:13:13 -0500 >> >>I'd love to see those pars, Andrew. Here's one for you (slow, but worth >>it!) >> >>61124009 { ; t= >>5:03:03.47 >> ; on a P233 at 1600x1200 Nov 27, 2000 05:07:51 >> ; Image Copyright 2000 by Lee H. Skinner ver=2001 >> ; Version 2001 Patchlevel 3 >> reset=2001 type=formula formulafile=fractint.frm >> formulaname=mandelbrotmix4 function=recip passes=1 >> center-mag=+2.71707619839821900/-0.94866867868312280/5936.513/1/-122.5 >> params=15/-1.15/1/-11.5/-2/500 float=y maxiter=3600 inside=0 >> logmap=231 symmetry=none periodicity=9 > > >formulafile=fractint.frm >formulaname=mandelbrotmix4 >Not on my system! Oh well, I'll have to wait for Jim's next C-FOTD, >in which he will inevatably repost that formula. (Well... maybe he'll just >my MandelbrotBC formula instead... or maybe even CubicMandelUnion! I can >dream can't I?...) OK, I now have the required .FRM on my system. That is indeed a slow image. And it does indeed look like it would be well worth compleating. I'll take the par home and run it on my AMD Duron 700MHz! Thanks Lee. Andrew. _____________________________________________________________________________________ Get more from the Web. FREE MSN Explorer download : http://explorer.msn.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Barry N. Merenoff" <110144.2274@compuserve.com> Subject: Re: (fractint) Re: C-FOTD 28-11-00 Date: 30 Nov 2000 17:16:21 -0500 Message text written by INTERNET:fractint@lists.xmission.com >I've tried that. It seems to draw a different image in Mandelbrot mode, = < Did you remember to change the starting value to the new critical point? Sincerely, Collin Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) FOTD 01-12-00 (4D-01 [NA]) Date: 30 Nov 2000 23:43:13 -0500 (EST) FOTD -- December 01, 2000 (Rating NA) Fractal visionaries and enthusiasts: At first glance, today's fractal may appear disappointing, but don't give up hope too soon, for today we begin our 12-day journey into the fourth dimension, that impossible yet real abstraction where planes intersect in a single point and surfaces have three-dimensional volume. The object of investigation is the period-4 bud on the northeast shore of the main bay of the Mandelbrot set. This bud, along with many of its associated filaments and midgets, is clearly illustrated in today's FOTD. The bud is described as being of period-4 because the iterated points within it have four separate attractors. I have not given today's image a name or rating because it not a separate unit, but rather the first in a series of 12 images, which must be considered as the unit. The series of images will follow the bud in today's image as it moves and rotates through the fourth dimension and eventually becomes its own Julia set. On the way, it will become clear that the actual four- dimensional shape of the bud is that of a hypercylinder. As a matter of interest, the mouth of the bud is located at the C coordinates of 0.25+0.50i. The center lies at C=0.281+0.531i, and the mouth of the bud is tilted at an angle of exactly 45 degrees. It is a very familiar feature of the Mandelbrot set, so familiar in fact that little attention is usually given to it. The things I will do to the bud in the next 11 images however should shake most of the familiarity out of it, and explain the four-dimensional nature of the Mandelbrot set, Julia sets, and Julibrot as well. Today's image as well as the eleven following images will render from their parameter files in a few seconds, making the download superfluous. But for those who would still prefer the download, the GIF image file may be found on Usenet at: and on the web at: The fractal weather today was cold and windy. Winter is now setting in fast, and today's temperature of 42F (5.5C) along with howling winds made it feel like winter has fully arrived. The fractal cats dislike winter. They'll most likely spend the next several months as they spent today -- curled by the warmest radiator. I'll shut down the fractal shoppe at this time, but the 4-D story will continue tomorrow and for the following 10 days as well. Until next time, take care, and can an abstraction be real? Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ 4D-01 { ; time=0:00:40.34 -- SF5 on a P200 reset=2001 type=formula formulafile=multirot.frm formulaname=multirot-XY-ZW function=flip/ident passes=t center-mag=-1.11022e-016/8.32667e-017/10.4\ 1667 params=0/0/0/0/0.281/0.531 float=y maxiter=3600 inside=0 logmap=yes periodicity=10 colors=00040P<4>90UA0VB2W<3>RF_VI`ZLa<3>nXbr_bvbbteb\ vf`<3>ijWfkVcjV<8>MiVKiVIiV<3>AiV<5>WS`_PacMb<3>qAfu\ CgxGguKh<4>SccWZp<9>cm`dnZdpY<3>guS<3>aqa`qdZpf<2>Vm\ nUmpVlk<3>ZlU_lP`lK<2>bl7<9>ekOekPekR<2>fkWfkXhiY<3>\ ld`nbaoaa<2>rYcigKaq0hd8nTGoHOmKQ<3>PTXJWZDY`7_a<3>D\ cWFcVGdU<2>LgQMgPOfR<3>WqYXt_Zwa`xbbyd<3>izkkzmmzonz\ p<3>czNazGZz9Xz2Yz6ZzA_zE<3>kzSnzWqz_tzbwzczzczzdzzd\ <4>zzYzzXzzW<3>zzSzzKzzD<3>zzUzzYzz_<5>zzlzzozzq<2>z\ zxzzzzzzzzzzzzzzzzzyzzxzzz<30>zzz } frm:multirot-XY-ZW {; draws 6 planes and many rotations ;when fn1-2=i,f, then p1 0,0=M, 0,90=O, 90,0=E, 90,90=J ;when fn1-2=f,i, then p1 0,0=M, 0,90=R, 90,0=P, 90,90=J a=real(p1)*.01745329251994, b=imag(p1)*.01745329251994, z=sin(b)*fn1(real(pixel))+sin(a)*fn2(imag(pixel))+p2, c=cos(b)*real(pixel)+cos(a)*flip(imag(pixel))+p3: z=sqr(z)+c, |z| <= 36 } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint"