From: "Zorba the Hutt" Subject: Re: (fractint) No hard feelings Date: 01 May 2001 03:26:32 -0400 > >Zorba generated the hi-res images with UF instead of > >Fractint - they appeared differently (having a different texture)than > >Sylvie originally generated - and so she had them removed mainly for that > >reason - they were no longer her images, and so Zorba's saying that they > >were her images was inaccurate. Had he generated them with Fractint, she > >may have approved, assuming that her permission was obtained first. > > Why ask for permission? The images were different and "no longer her images"! > Zorba gave acknowledgement that the .par files had been produced by Sylvie > but he *did* feel that it was the right thing to delete them. I really don't want > to put Zorba on the spot over this, so Zorba, if you're listening I'm not asking > you to reply! I just don't understand; but then I'm probably being thick! I'm listening, and I don't mind replying :) Here's my basic take on it - I have a very liberal idea of open information. For example, IMHO the GPL license is TOO RESTRICTIVE because it forces any derivative libraries or anything that makes use of it to be GPL as well. Even LGPL is stretching things. The license I personally use for writing software is, as far as I know, called the libpng/zlib license, and basically comes down to "this is ours. Don't claim it's yours. Beyond that, though, go for it! It'd be nice if you mentioned us when you make ten billion dollars off it, but, hey, no worries." So now you know where I'm coming from :) Now, as for why ask permission/remove on request, it's because I didn't make those .par files. Sylvie Gallet did. And she might not (and clearly doesn't, actually) agree with my views. I don't feel right imposing my views on others, though due to the nature of the Internet doing such things would be basically unstoppable (yeah, I've got your images on a server in Russia. And I claim they're mine, too. Whatcha gonna do about it?). If anything, that makes it *worse*, because I don't have any measure of how much you care (since you really *wouldn't* be able to do anything about it.) So, yes, it might be my CPU cycles, it might be my time spent, it might even be my slight modifications, as I had to shift the viewport slightly to accomodate a different aspect ratio without stretching. But the base images were Sylvie's, and I don't feel right to put them up there if she doesn't want them up. Now, there *is* a point at which I say something like "well, tough", and that's when it's essentially no longer the creator's creation. For example, putting me in Sylvie's place, if Jim Muth had said "no, I don't want you using my original fractal to work off of" (remember, the fractals of Sylvie's in question were further explorations of one of the FOTD) I would have said something along the lines of "well, I respect that you might want them removed, but these aren't even remotely similar to yours and are only based off a mathematical formula that you happen to have discovered a particular permutation of. I'll happily give you credit, and I'm not going to make any money off them, but they're *my* art and I'll put them up if I want." So there you have it. This might also explain why the "oh, by the way, do you mind?" was tacked on to the original posting of mine - it's because it really didn't occur to me up until just before I hit "send" that she *might*. I mean, it's fanart, really - my CPU cycles and webspace (okay, Geocities's webspace) devoted to her work :) Anyway. On a slightly different note, it's pretty unlikely that I'll do the re-rendering with Fractint, for multiple reasons - no built-in antialiasing, for example, and it multitasks pretty badly with Windows. If I can figure out how to duplicate the exact images in Ultrafractal (I haven't even gone back to see the differences yet, actually) I might try, but considering that one complaint was the color banding (which I can't imagine how it could possibly be *worse* on UF than Fractint) and the antialiasing (which I consider totally incomprehensible from an artistic standpoint - if anything, it makes it *more* detailed, IMHO, but, hey, some people like abstract art too, so who am I to judge?) it's not very high on my list. Anyway, I'm curious about any replies people might have - if you don't want to spam the list with an age-old question, I'll cheerfully take private comments also. -Zorba (oh, and sorry for the delay, was out of town for an anime convention :D ) Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Zorba the Hutt" Subject: Re: (fractint) Fractint version 20.1.08 Date: 01 May 2001 03:30:40 -0400 > I am not an Ultra Fractal user, but doesn't it generate par files of > true-color images? (Perhaps some UF user could shed light on how this > might be implemented.) I'm not a UF expert by any means, but as I understand it UF bases its color maps off of curves - for example, you'd say "position 0 is rgb(0, 0, 0), position 128 is rgb(255, 255, 255), position 255 is rgb(0, 0, 0)", and it interpolates from there. UF can actually load Fractint pars, and it snags all the color values and sets them. I can't remember what it does from there - I *think* it discards redundant entries (i.e. "0 is (0, 0, 0), 1 is (1, 1, 1), 2 is (2, 2, 2)" - why not get rid of 1?) but I could be misremembering. IMHO, UF's method isn't even close to ideal, but it works, and I can't think of anything better right now :) -Zorba Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "David Jones" Subject: Re: (fractint) Linux Fractint Date: 30 Apr 2001 22:45:03 -1000 Where'd you get Fractint for Linux? Would love to see how it goes on my 700MHz Duron box ... David gnome@hawaii.rr.com On 30 Apr 01 at 14:50, Andrew Coppin wrote: > I don't know who did the Linux Fractint post, but HATS > OFF TO THEM! > > Yesterday, after wanting to have a Linux Fractint for > AGES, I got someone to download the source for me. I let > him compile it, thinking it would be a nightmare. The > guy typed "make", half a million lines of text flew > past, and an executable appeared. He executed it, and it > just worked. > > I would never have believed it if I hadn't seen it for > myself! > > BTW, this was on an Athlon 1GHz machine. Once I reached > arbitary precition mode, it was *still* rapping off 2 > lines per second! Man, I *want* his machine!!! > > Once again, a big thanks to whoever it was who made this > thing! > > Thanks. > Andrew. > > ________________________________________________________ > _________________ Get Your Private, Free E-mail from MSN > Hotmail at http://www.hotmail.com. > > > -------------------------------------------------------- > ------ Thanks for using Fractint, The Fractals and > Fractint Discussion List Post Message: > fractint@lists.xmission.com Get Commands: > majordomo@lists.xmission.com "help" Administrator: > twegner@fractint.org Unsubscribe: > majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Scott D. Boyd" Subject: Re: (fractint) Linux Fractint Date: 01 May 2001 07:30:36 -0500 David, Xfractint is available at the usual locations: The main Fractint website: http://spanky.triumf.ca/www/fractint/fractint.html The Fractint DevelopmentTeam homepage: http://www.fractint.org and I offer a precompiled binary package of Xfractint 20.1.04 at my Website: http://sdboyd.dyndns.org/~sdboyd/xfractint/xfractint.html On Tuesday 01 May 2001 03:45, David Jones wrote: > Where'd you get Fractint for Linux? Would love to see how > it goes on my 700MHz Duron box ... > Scott Boyd -- sdboyd56@swbell.net http://sdboyd.dyndns.org/~sdboyd/ I always wanted to be a procrastinator, but I never got around to it. -- Unknown Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: Re: (fractint) Linux Fractint Date: 01 May 2001 14:05:29 -0000 The best part is that I can now *finally* run Fractint on my Amiga... Well, I can assuming 1) I can fix my floppy drive and 2) it compiles there as easily as it did on my associate's PC... Thanks. Andrew. PS. Maybe I'll wander though the source code some time... >From: "Scott D. Boyd" >Reply-To: fractint@lists.xmission.com >To: fractint@lists.xmission.com >Subject: Re: (fractint) Linux Fractint >Date: Tue, 01 May 2001 07:30:36 -0500 > >David, > >Xfractint is available at the usual locations: > >The main Fractint website: >http://spanky.triumf.ca/www/fractint/fractint.html > >The Fractint DevelopmentTeam homepage: http://www.fractint.org > >and I offer a precompiled binary package of Xfractint 20.1.04 at my >Website: http://sdboyd.dyndns.org/~sdboyd/xfractint/xfractint.html > >On Tuesday 01 May 2001 03:45, David Jones wrote: > > Where'd you get Fractint for Linux? Would love to see how > > it goes on my 700MHz Duron box ... > > >Scott Boyd >-- >sdboyd56@swbell.net >http://sdboyd.dyndns.org/~sdboyd/ >--------------------------------------- >I always wanted to be a procrastinator, >but I never got around to it. > -- Unknown _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: Re: (fractint) Re: C-FOTD 18-04-01 (Fractured Fractal [6]) Date: 01 May 2001 14:08:28 -0000 >From: "Morgan L. Owens" >Reply-To: fractint@lists.xmission.com >To: fractint@lists.xmission.com >Subject: Re: (fractint) Re: C-FOTD 18-04-01 (Fractured Fractal [6]) >Date: Sat, 28 Apr 2001 17:07:15 +1200 > >At 23:51 25/04/2001, Andrew Coppin wrote: > >>PS. Hey Morgan... What the hell _are_ "sheets in the Riemann surface"? > >One of the hassles involved with many functions is that they are many- >valued (and hence, strictly speaking, not functions at all). I have another even more technical question... How do you pronounce "Riemann"?!?! Thanks. Andrew. Random Though of the Day: average(x, y, z) = (x+y+z)/3. What happens if you use average(x, y, z) = (x*y*z)^(1/3)? _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Lee Skinner Subject: (fractint) Acknowledgments due? Date: 30 Apr 2001 09:05:32 -0400 Hi Chris, >> Poor old, (young), Zorba the Hutt who spent hours generating high resolution versions of fractals to delight others with slower machines, i= s then shamed into deleting them because they are the 'property' of the esteemed Sylvie Gallet, (may her .map files continue to delight us all). = << Fractint and Ultra Fractal do not always generate identical images from t= he same par file. In this case, Sylvie generated the images with Fractint an= d posted Fractint pars. Zorba generated the hi-res images with UF instead = of Fractint - they appeared differently (having a different texture)than Sylvie originally generated - and so she had them removed mainly for that= reason - they were no longer her images, and so Zorba's saying that they were her images was inaccurate. Had he generated them with Fractint, she= may have approved, assuming that her permission was obtained first. I don't think Zorba was aware of the differences when he posted them. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) C-FOTD 22-04-01 (Minibrot with Aura [7]) Date: 01 May 2001 12:19:11 -0500 Jim Muth wrote: > If I can find a trashy enough old sci-fi movie to watch, the day will > be complete. Ever seen ZARDOZ ?? -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 01 May 2001 12:29:11 -0500 Jim Muth philosophized: > ...I pondered about gravity and dark matter. The problem is that > the outer parts of the galaxies are rotating too fast to be caused > by the gravity created by the visible matter of the galaxies. To > account for this discrepancy, astronomers have hypothesized that > the galaxies are filled with large amounts of undetectable > material they have named dark matter, and this unseen material > is causing the excess gravitational acceleration. But this > explanation is not satisfactory, since if the matter cannot be > detected, it will be most difficult if not impossible to confirm > its existence. Just a note: we can't detect it only because it does not emit light that we can see. Dark matter *could* just be ordinary, cold matter, and we would never be able to see it...from earth. If we can ever get out into the galaxy and universe, THEN we'd probably have no problem detecting it. > ...and this is to assume that, like so many other natural phenomena, > the Newtonian law of gravity is valid only within a limited range,... This is already known, established fact. For example, Newton's laws cannot quite account for the orbit of Mercury. You need to use Albert's GR (General Relativity) laws to precisely figure the orbit. This is because of the gravitational force from the nearby sun! So we *know* Newton is a 'special case' version of the full laws of motion. On the other hand, a great deal of modern physics is based on the fact (or more properly, assumption) that the laws of the universe are true throughout the universe. This assumption has been explored in a variety of ways, and largely seems to be taken as fact. But who knows what really lies across the dark void, eh? > Since this alternate explanation is so obvious, it must have > already been thought of by many astronomers, and probably > discarded because it contains a fatal flaw. 'Fraid so. ;-( -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) Fractint version 20.1.08 Date: 01 May 2001 12:32:49 -0500 Jonathan Osuch wrote: >> Given that you've GOT an image and that free PNG libraries exist, I'm >> curious why you can't save a t/c image? > > Memory. Because of the memory model we are using (medium), we can't fit > the PNG libraries into Fractint. Wow! You ARE up against the limit!! Wonder if it'd be worthwhile having the program start some sort of separate "image server" process you could hand off the t/c image to for saving? It could be a quick fix way to implement saving.... [shrug] But whaddo I know about the intricacies of FractInt. -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) Re: C-FOTD 22-04-01 Date: 01 May 2001 15:04:57 -0400 (EDT) At 12:19 PM 5/1/01 -0500, Programmer D. wrote: >Jim Muth wrote: > >> If I can find a trashy enough old sci-fi movie to watch, the day will >> be complete. > >Ever seen ZARDOZ ?? Yes! wiZARDofOZ is one of my favorites. I play it at least once a month. It's plenty trashy. Rambling story, flying heads, men in diapers, topless women -- it has everything. And Beethoven's 7th, the second movement of which serves as the main theme music, is one of my favorite symphonies. I also have spotted many fractal-like figures in the background, though I believe the film was produced before the awareness of fractals became widespread. BTW, have you ever seen the 1970 Soviet production of SOLARIS? Jim M. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: (fractint) Linux Fractint Date: 30 Apr 2001 14:50:31 -0000 I don't know who did the Linux Fractint post, but HATS OFF TO THEM! Yesterday, after wanting to have a Linux Fractint for AGES, I got someone to download the source for me. I let him compile it, thinking it would be a nightmare. The guy typed "make", half a million lines of text flew past, and an executable appeared. He executed it, and it just worked. I would never have believed it if I hadn't seen it for myself! BTW, this was on an Athlon 1GHz machine. Once I reached arbitary precition mode, it was *still* rapping off 2 lines per second! Man, I *want* his machine!!! Once again, a big thanks to whoever it was who made this thing! Thanks. Andrew. _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 30-04-01 (A Ghostly Spectre [4]) Date: 30 Apr 2001 10:01:42 -0400 (EDT) Classic FOTD -- April 30, 2001 (Rating 4) Fractal visionaries and enthusiasts: Today's hasty fractal was created by the formula 2Z^(-2.1)-2Z^(-1.9)+(1/C). I named it "A Ghostly Spectre" when I noticed that the seahorse-like detail surrounding the midget is clearly visible only when certain broad color palettes are applied to the image. With a narrow color scheme such as F2, the detail vanishes and the image becomes a featureless screen full of fractal sand. The location of today's image is in an elephant trunk in the East Valley area of a larger midget, which is resting in a chaotic part of the parent fractal. I rated the image at a 4. This is all I could give to a fractal that I found and colored with so little effort. With a running time of exactly 15 minutes, the parameter file might not be the best way of viewing the image, which will be available for download and viewing in an hour or so at: and at: One of these days when things settle down, I'm going to gain convenient access to ABPF, and resume posting the images there. But so far I haven't had the chance to recover from the move of Fractal Central auxiliary. With sunny skies and a temperature of 68F (20C), the fractal weather today was so good that I took the day off. When I returned, the cats scolded me for not being there to let them out to enjoy the fine weather. To soothe them, I gave them a treat of tuna and promised to do better next time. And speaking of next time, it will come in about 13 hours. Until then, take care, and watch out for those fractal ghosts. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ A_Ghostly_Spectre { ; time=0:15:00.01--SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+1.584484530091595/+1.150509782717139/7\ 774320/1/132.5 params=1/-2.1/-1/-1.9/1/300 float=y maxiter=1800 inside=0 logmap=205 periodicity=10 colors=000i_zg_zg_zfYzfYzdYzdYzbWzbWzbWzaWzaVz_Vz_\ VzYVzYTzXTzXTzSRzVTzVTzXTzXVzXVzYVzYVz_Wz_Wz_WzaWz\ aYzbYzbYzbYzd_zd_zf_zf_zf`zg`zg`zi`zibzibzkbzkbzlc\ zlczlczncznfznfzpfzphzqhzqhzqhzsizsizuizuizukzwkzw\ kzxkzxnzxnzznzzozzpzzpzzqzzqzzszztzztzztzzwzzwzzwz\ zxzzyzzzzzzzzzzzzzzxzzxzzvzzuzztzzszzpzzpzzpzzpzzn\ zxnzxnzwnxumwumwsmusmsqksqkqpjpshsqfqpdpnbplank`ni\ _lgZlfYkdXkbWiaVi_UgYTgXSfVRfSQdRPbPObONaMMaKL_JK_\ JJYHIYFHXEGXCFVAEV8DS7CS6BR4AP29P18O07O07M07M07K07\ K07J07J07H07H07F07H07F07F07F07F07E07E07E05E07C07C0\ 7C07C17C47A68A68A7BA8B8AD8CE8EE8FF7FF7HC7JE7KE7MG6\ OG6PH6RK6RL4SO4VQ4XR4YU1_V1aY1b_1b`1db0fb0gc0if0kf\ 0lh0lh0ni0pk0qk0sm0um0wn0xp0xp0zr0zr0zs0zu0zu0zw0z\ w0zx0zx0zx0zx0zx0zx0zx0zz0zz1zz1zz4zz4zz6zz6zz7zz7\ zz8zz8zzAzzAzzAzzAzzAzzAzzAzzAzzAzzAzzAzzAzzAzzAzz\ AzzAzzAzzAzzAzzAzzAzzAzzA } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Lee Skinner Subject: (fractint) Fractint version 20.1.08 Date: 30 Apr 2001 09:05:33 -0400 Jonathan, >> Fractint version 20.1.08 is now available at the developer's web site.= >> Features in this patch: >> Added truecolor support to Fractint thanks to Bert Tyler. = I presume that there is no way to save a true-color par file yet either. Is there any mechanism yet for manipulating the true colors? Lee Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Lee Skinner Subject: (fractint) Fractint version 20.1.08 Date: 30 Apr 2001 09:05:33 -0400 Jonathan, >> Fractint version 20.1.08 is now available at the developer's web site.= >> Features in this patch: >> Added truecolor support to Fractint thanks to Bert Tyler. = I presume that there is no way to save a true-color par file yet either. Is there any mechanism yet for manipulating the true colors? Lee Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Ricardo M. Forno" Subject: RE: (fractint) Re: C-FOTD 18-04-01 (Fractured Fractal [6]) Date: 01 May 2001 19:34:08 -0300 It is pronounced Reemahn. About averages: (x*y*z) ^(1/3) averages by the logarithms. ----- Original Message ----- Sent: Tuesday, May 01, 2001 11:08 AM > >From: "Morgan L. Owens" > >Reply-To: fractint@lists.xmission.com > >To: fractint@lists.xmission.com > >Subject: Re: (fractint) Re: C-FOTD 18-04-01 (Fractured Fractal [6]) > >Date: Sat, 28 Apr 2001 17:07:15 +1200 > > > >At 23:51 25/04/2001, Andrew Coppin wrote: > > > >>PS. Hey Morgan... What the hell _are_ "sheets in the Riemann surface"? > > > >One of the hassles involved with many functions is that they are many- > >valued (and hence, strictly speaking, not functions at all). > > I have another even more technical question... How do you pronounce > "Riemann"?!?! > > Thanks. > Andrew. > > Random Though of the Day: average(x, y, z) = (x+y+z)/3. What happens if you > use average(x, y, z) = (x*y*z)^(1/3)? > > > _________________________________________________________________________ > Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. > > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Kathy Roth Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 01 May 2001 17:57:15 -0700 Programmer Dude wrote: > > Jim Muth philosophized: > > > ...I pondered about gravity and dark matter. The problem is that > > the outer parts of the galaxies are rotating too fast to be caused ...................... > Just a note: we can't detect it only because it does not emit light that > we can see. Dark matter *could* just be ordinary, cold matter, and we > would never be able to see it...from earth. If we can ever get out into > the galaxy and universe, THEN we'd probably have no problem detecting it. > Aren't we IN the universe? Kathy Roth Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: DeBow Freed Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 01 May 2001 20:47:06 -0500 Shocking, iconoclastic suggestion. The Clintonian answer is :"it depends on who/what/where/when "we" be(is). Kathy Roth wrote: > Programmer Dude wrote: > > > > Jim Muth philosophized: > > > > > ...I pondered about gravity and dark matter. The problem is that > > > the outer parts of the galaxies are rotating too fast to be caused > ...................... > > > Just a note: we can't detect it only because it does not emit light that > > we can see. Dark matter *could* just be ordinary, cold matter, and we > > would never be able to see it...from earth. If we can ever get out into > > the galaxy and universe, THEN we'd probably have no problem detecting it. > > > > Aren't we IN the universe? > Kathy Roth > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Lee Skinner Subject: (fractint) Fractint version 20.1.08 Date: 01 May 2001 21:47:21 -0400 More duplicate messages from previous days are coming across again! Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 02-05-01 (Heads Up Mister Midget [7]) Date: 01 May 2001 22:55:28 -0400 (EDT) Classic FOTD -- May 02, 2001 (Rating 7) Fractal visionaries and enthusiasts: I rated today's image a 7 because of how well the colors turned out. Although it has only 256 colors, the bands are almost invisible, resulting in a GIF image as close to the appearance of true-color as one is likely to see. I named the picture "Heads Up Mister Midget" when I noticed that the sqrt(3) midget looks almost like a quadratic midget with its nose in the air. For today's image I once again chose the new MandelbrotBC1 formula and calculated the fractal produced by the square root of 3. But this time I set the function to , which unlike the and functions, draws images different from those drawn by the function. The parent of today's image is a Mandeloid shaped almost exactly like the midget in yesterday's "Decorative" FOTD. Today's midget, which is shaped exactly like its parent, lies rather deep in a seahorse tail in the Seahorse Valley area of its parent. The branch-cut discontinuities are quite pronounced in this image, making me wish that some way of eliminating them existed. But of course, the breaks are an unavoidable part of fractals with fractional exponents. After several of very fast parameter files, today's is a slow one, taking over 19 minutes to render on a 200mhz Pentium. For those who cannot spare the computer time, the GIF file of the rendered image will be available in an hour or so on the Web at: and at: The fractal weather today was absolutely perfect. The warm sun, cloudless sky, and temperature of 83F (28C) lured the cats into the yard for a full day of enjoyment. They saw no fox, though a raccoon barely escaped detection. And now I once again see that it's time to shut down the olde fractal shoppe and call this day ended but for the wind-down. I'll return in 24 hours however. Until then, take care, and I hear that an apple used to be known as a napple. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Heads_Up_Mr_Midget { ; time=0:19:07.17--SF5 on a p200 reset=2001 type=formula formulafile=branchct.frm formulaname=mandelbrotbc1 function=ceil passes=1 center-mag=+0.73481980084589390/+0.136649099636705\ 70/1.795448e+007/1/-172.499 params=1.73205080807569/0/0/0 float=y maxiter=25000 inside=0 logmap=411 periodicity=10 colors=000YbMZdN_fO`hPbjQclRdnScoSepSfpShqSiqSkqSl\ rSmrSorSpsSrsSssSusSvsSyrUwsSusQssOqsNosLmsJlsIjsG\ hsEfsDdsBbs9ar8`q9`p9_oA_mA_kBZiBZgCYeCYcDYaDX_EXY\ EWWFXVFYU4ZUF_SR`SPaRObRMcQLdQKePIgPHhOGjOElODnPBp\ QAqR9sS7uT6wT2vU5vW8vYBv_DubGudJugMuiOtlRtnUtqXtsY\ tsZtsZts_ts_ts`ts`tsatsatsbtsbtsctsctqcmpdfme_jfTg\ gMehGeiLfkPhlTkmXmnappesqitrmutfum`qiVlcPhWIdMC_G6\ W90S3jzcfvecrf_ngXjiUgjQckN`mJXnGUoCSpDQpDOmEMjEJf\ EHcFE`FBXG9UG6RC0KG4OK8ROCURGXVK`ZOcaSfeYiicmlhppm\ stpvwrywtuwrrwpownlwliwjfwhcwf`weYwdVwcSwcPrdTmdXh\ d`cdd_dgVdkQdoLdsIfzHdvHcsGaoGblFchFeeEgbEiZDkWDmS\ CmPCmLBmI1mGBmFLmFVmE_m0dmESmRFmd1mt2mq2mo2ml3mj3m\ h3me4mc4m`4mZ5oX5qU5sS6uP6wN6yL8zI9zFAzCBz9Ez8Hz8J\ z8Mz8Oz7Rz7Uz7Wz7Zz6`z6cz6fz6hz5kz5mz5pz5sz4uz4xz4\ zz4zz6zz8zzAzzCzzEzzFzzHzzJzzLzzNzzOzzQzzSzzUzzWzz\ XyzWxzWQzGRzHTzIUzJVzKWzL } frm:MandelbrotBC1 { ; by several Fractint users e=p1, a=imag(p2)+100 p=real(p2)+PI q=2*PI*fn1(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z| Subject: Re: (fractint) Linux Fractint Date: 01 May 2001 22:36:48 -1000 Thanks, I look forward to it! 8-) David gnome@hawaii.rr.com On 1 May 01 at 7:30, Scott D. Boyd wrote: > and I offer a precompiled binary package of Xfractint > 20.1.04 at my Website: > http://sdboyd.dyndns.org/~sdboyd/xfractint/xfractint.htm > l Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 02 May 2001 09:26:33 -0500 Kathy Roth wrote: > Programmer Dude wrote: >> Jim Muth philosophized: >> >>> ...I pondered about gravity and dark matter. >> >> Dark matter *could* just be ordinary, cold matter, and we >> would never be able to see it...from earth. If we can ever >> get out into the galaxy and universe, THEN we'd probably >> have no problem detecting it. > > Aren't we IN the universe? [grin] Touche! (But not OUT inTO [deep space]...) -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) Fractint version 20.1.08 Date: 02 May 2001 09:29:02 -0500 Lee Skinner wrote: > More duplicate messages from previous days are coming across again! Say what? Lee Skinner wrote: > More duplicate messages from previous days are coming across again! Say what? -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "J. Covey" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 02 May 2001 07:44:04 -0700 (PDT) --- Programmer Dude wrote: > This is already known, established fact. For > example, Newton's laws > cannot quite account for the orbit of Mercury. You > need to use Albert's > GR (General Relativity) laws to precisely figure the > orbit. This is > because of the gravitational force from the nearby > sun! > > So we *know* Newton is a 'special case' version of > the full laws of > motion. > Actually, the perihelion advance formula for the orbit of Mercury can be derived from classical, flat-space-time principles in a manner that is far simpler than Einstein's own derivation. This discovery completes an alternative interpretation for all GR's major effects. So the question is, "What the heck use is GR anyway?" Jim __________________________________________________ Do You Yahoo!? Yahoo! Auctions - buy the things you want at great prices http://auctions.yahoo.com/ Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Chris Curnow" Subject: (fractint) Thanks for the input Date: 02 May 2001 19:22:22 +0100 This is a multi-part message in MIME format. ------=_NextPart_000_0019_01C0D33D.363FF1C0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable Enough said. =20 Thanks for all the responses about the 'ownership' issue. I'm still not = convinced but that's OK. I'm going back to writing a really stunning = .map=20 file generator; should get it done just in time for Version 21 when we=20 won't need one any more! Cheers, Chris ------=_NextPart_000_0019_01C0D33D.363FF1C0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
Enough said.  =
 
Thanks for all the responses = about the=20 'ownership' issue.  I'm still not
convinced but that's = OK.  I'm going=20 back to writing a really stunning .map
file generator; should get it = done just=20 in time for Version 21 when we
won't need one any = more!
 
Cheers,
Chris
------=_NextPart_000_0019_01C0D33D.363FF1C0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 03 May 2001 12:26:16 +1200 At 02:44 03/05/2001, J. Covey wrote: >So the question is, "What the heck use is GR anyway?" Who knows? Making accurate use of GPS timing signals, perhaps? Morgan L. Owens "It's like reality, but over there!" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jonathan Osuch" Subject: Re: (fractint) evolver bug? Date: 02 May 2001 20:51:54 -0500 Guy, > in an .frm working with 4 functions (fn1-fn4) I need to play with fn1-fn3 > but not with fn4. Fn4 is set to 'sinh' and has to stay so. Starting the > Evolver with the 'fn4=no' option (but set to 'sinh' in the Z-screen) all > the pictures are generated with 'fn4=sin' except the first one.. I found the problem. We're trying to put a two byte value into a one byte space. As long as all the functions are getting evolved, the error doesn't show up. This is because the zero entered into the second byte gets overwritten by the value for the next function. I'll need to dig into the code some more to see if this affects the history routine and saved images. The fix will be in my next patch. Jonathan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mark Christenson Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 04 Apr 2001 19:25:00 -0700 At 07:44 AM 5/2/01 -0700, Jim Covey wrote: >... >Actually, the perihelion advance formula for the orbit >of Mercury can be derived from classical, >flat-space-time principles in a manner that is far >simpler than Einstein's own derivation. This discovery >completes an alternative interpretation for all GR's >major effects. I would like to hear more about this! (Maybe off-list.) >So the question is, "What the heck use is GR anyway?" It would, among a great many other things, tell us how to generate the only physical force we currently can't (gravitation). Unfortunately the fact that physicists have built huge particle accelerators and don't have the answers suggests that the energies, and consequently the scale of hardware required, may prove too large to be of any practical use. We can only hope that God (or dumb luck, depending on your beliefs) permits a shortcut somehow. Otherwise we can forget our Sci-Fi dreams of gravitational propulsion, force fields, and artificial gravity :-( ... and "flying discs" ;-) Bud Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mark Christenson Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 04 Apr 2001 20:38:40 -0700 At 07:25 PM 4/4/01 -0700, I wrote: >At 07:44 AM 5/2/01 -0700, Jim Covey wrote: >>... >>So the question is, "What the heck use is GR anyway?" > >It would, among a great many other things, tell us how >to generate the only physical force we currently can't >(gravitation). >... Man, did I go off course. Thought you were talking GUT... Sorry... Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 03-05-01 (Seahorse Minibrot [5]) Date: 03 May 2001 00:26:40 EDT Classic FOTD -- May 03, 2001 (Rating 5) Fractal visionaries and enthusiasts: All too often we forget the most basic of all fractals, the classic Mandelbrot set. We cast it aside with an attitude that everything of interest in the set has already been worked to death. Even I, a conservative fractal purist, tend to overlook the faithful old M-set, with its infinite nooks and crannies. Well, today, for at least one day, I have corrected my oversight by exploring the best-known area of the M-set -- Seahorse Valley. True, I did venture rather deep into the valley to find today's midget, but not so deep as to need arbitrary precision math. The midget at the center is shaped unusually perfect, unlike many midgets in Seahorse Valley, which, along with the midgets in East Valley, are some of the most distorted in the entire M-set. The midget is located on the filament of a bud, where the filament merges with one of the triple bottomless pits that characterize the deep Mandelbrot valleys. I named the image "Seahorse Minibrot" in recognition of the fact that the scene lies in Seahorse Valley. I rated it a perfectly average 5, admitting that this area has already been thoroughly explored. Lying so deep in Seahorse Valley, the image has an unusually high maxiter, which results in a render time from the parameter file of over 28 minutes. A better way to view the image is to give Paul and Scott a chance to render and post the GIF file to their web sites at: and at: and download the image from there. The fractal weather today was like mid-summer, with clear skies, hot sun, and a temperature of 86F (30C). The fractal cats spent over an hour outdoors, but when they returned, they complained that it was too hot. That's it for now. The philosophy is still building, and may soon burst forth in its full glory. But philosophy or not, I'll return tomorrow with another fractal and more fractal talk. Until then, take care, and be of stout heart but slim body. Jim Muth jamth@mindspring.com START PARAMETER FILE======================================= Seahorse_Minibrot { ; time=0:28:38.08--SF5 on a P200 reset=2001 type=mandel passes=1 center-mag=-0.74997725991656570/+0.00836815652421319\ /3.939857e+008/1/-52.5 params=0/0 float=y maxiter=500000 inside=0 logmap=-17500 periodicity=10 colors=00009008404802D01G00L00O00V00_60dE0iN0nX0sd0x\ l0zt0zz0zw0zq1zl9zgJzbTzXazRkzVtzfzzrzzjzzdzzUnxKVtK\ DmG0mI0mJ0mJ0mL0mL0mN0mOAmOKmQRmQRmRRkTRgTRdVRaVR_XR\ XYRTYRQ_RN_RLbTOdVQgXTiYVl_Yna_pbasddtffxgizikzknzlp\ znqzptzqwzszztzztzzwzzxzzzxwzwqztlzsgzqbzqYzpTznOzlJ\ zkEzi9zg4zg8zf9zdBzbDzbEzaGz_IzYJzYLzXOzVQzTRzTTzRVz\ QXzOYzO_zNazLbzLazQazV_zY_zbYzgXzkXzpVztRzzTzzVzxXzp\ XzgYz__zR_zJazBbz2_z0bz0fz0gz0kz2nz4pz6sz8wzBxzDzzEz\ zIzzJzzLzzOzzNzzNzzNzzNxzNtzNqzNlzNizNdzLazLXzLTzLQz\ LLzLIzLDzL9zL8zI6zL6zN6zO6zQ6zR6zT6zV6zY6z_6za6zb6zd\ 6zf6zg4zf6zi6zk6zl6zn6zq6zs6zt6zw6zz6zz6zz6zz6zz9zzB\ zwDzqEzlIzgJzdLz_NzVQzQRzLTzGVzD_zBdz9iz8nz6sz4xz2zz\ 1zz0zz0zz0zz0zz0zz0zz1lzzkzzizzgzzfzzdzzazz_zzYzzXzz\ VzzTzzRzzTzxVztXzpXzlYzg_zdYzlYzt_zaazG_z0bz0dz0gz0i\ z0lz0nz0pz0nz0lz1lz8kzDkzJizOizVgz_gzdbzb_zaXza } END PARAMETER FILE========================================= Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) Re: C-FOTD 22-04-01 Date: 03 May 2001 10:15:46 -0500 Jim Muth wrote: >>> If I can find a trashy enough old sci-fi movie to watch, the day will >>> be complete. >> >> Ever seen ZARDOZ ?? > > Yes! wiZARDofOZ is one of my favorites. Oh, no!! You just gave away the secret! ;-) > I play it at least once a month. It's plenty trashy. And yet.... it's actually pretty good (I think). I think it's a brilliant example of British low-tech/hi-tech SF. By that I mean the use of simple, low tech things to suggest a technology so high that it doesn't resemble technology anymore (Dr Who does this too, but with more kitsch ). And it has so many interesting ideas in it: punishing immortals by aging them, the "mainframe-in-a-diamond" and many more. It's in my top twenty SF films ever (along with SLAUGHTERHOUSE FIVE, SILENT RUNNING, 2001, DARK CITY (outstanding recent SF film), FIFTH ELEMENT...). > I also have spotted many fractal-like figures in the background,... Yeah? Share with us?? Please??? > BTW, have you ever seen the 1970 Soviet production of SOLARIS? Wow. Not in 30 years, at least! Hmmmm, wonder where I could find one. -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 03 May 2001 10:21:48 -0500 "J. Covey" wrote: > Actually, the perihelion advance formula for the orbit > of Mercury can be derived from classical, > flat-space-time principles in a manner that is far > simpler than Einstein's own derivation. This discovery > completes an alternative interpretation for all GR's > major effects. To quote Mr. Spock, "Fascinating!" Can you provide a link or three? I'd like to pursue this. For one thing, I'd be interested in seeing how they account for the bending of light by gravity. -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Thierry B." Subject: (fractint) Chaos and TCP/IP Date: 03 May 2001 15:35:14 +0000 http://razor.bindview.com/publish/papers/tcpseq.html -- Thierry Boudet http://la.buvette.org/ Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: RENRAD1@aol.com Subject: Re: (fractint) Chaos and TCP/IP Date: 03 May 2001 14:36:57 EDT In a message dated 01-05-03 11:35:46 EDT, you write: << http://razor.bindview.com/publish/papers/tcpseq.html >> Fascinating paper, thanks for posting the URL. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Ricardo M. Forno" Subject: RE: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 02 May 2001 21:41:21 -0300 Aren't we IN a galaxy? ----- Original Message ----- Sent: Tuesday, May 01, 2001 9:57 PM > > > Programmer Dude wrote: > > > > Jim Muth philosophized: > > > > > ...I pondered about gravity and dark matter. The problem is that > > > the outer parts of the galaxies are rotating too fast to be caused > ...................... > > > > Just a note: we can't detect it only because it does not emit light that > > we can see. Dark matter *could* just be ordinary, cold matter, and we > > would never be able to see it...from earth. If we can ever get out into > > the galaxy and universe, THEN we'd probably have no problem detecting it. > > > > > Aren't we IN the universe? > Kathy Roth > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Guy Marson Subject: Re: (fractint) Re: C-FOTD 18-04-01 (Fractured Fractal [6]) Date: 04 May 2001 07:55:20 +0200 Hi Andrew, At 14:08 01/05/01 -0000, you wrote: >I have another even more technical question... How do you pronounce >"Riemann"?!?! Riemann is simply Riemann or in an english translation I say: REEMAN(n) = with double 'n' > >Thanks. >Andrew. But are you able to translate the following into a working .frm? > >Random Though of the Day: average(x, y, z) = (x+y+z)/3. What happens if you >use average(x, y, z) = (x*y*z)^(1/3)? > cheers, Guy Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Guy Marson Subject: Re: (fractint) evolver bug? Date: 04 May 2001 10:36:12 +0200 At 20:51 02/05/01 -0500, you wrote: >Guy, > >> in an .frm working with 4 functions (fn1-fn4) I need to play with fn1-fn3 >> but not with fn4. Fn4 is set to 'sinh' and has to stay so. Starting the >> Evolver with the 'fn4=no' option (but set to 'sinh' in the Z-screen) all >> the pictures are generated with 'fn4=sin' except the first one.. > >I found the problem. We're trying to put a two byte value into a one byte >space. As long as all the functions are getting evolved, the error doesn't >show up. that's right! >This is because the zero entered into the second byte gets >overwritten by the value for the next function. > >I'll need to dig into the code some more to see if this affects the history >routine and saved images. The fix will be in my next patch. > oh thanks a lot! So I'll wait with my tests until it's fixed! >Jonathan > > cheers, Guy Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Thomas Bennett Subject: RE: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 04 May 2001 05:20:12 -0700 (PDT) > > Programmer Dude wrote: > > > > > > Jim Muth philosophized: > > > > > > > ...I pondered about gravity and dark matter. > The problem is that > > > > the outer parts of the galaxies are rotating > too fast to be caused > > ...................... > > > > > > > Just a note: we can't detect it only because it > does not emit light that > > > we can see. Dark matter *could* just be > ordinary, cold matter, and we > > > would never be able to see it...from earth. If > we can ever get out into > > > the galaxy and universe, THEN we'd probably have > no problem detecting > it. > > > > > > > > > Aren't we IN the universe? > > Kathy Roth > > I, unfortunately, find these esoteric discussions somewhat off the point and containing little, if anything, relevant to the construction of fractals. Tom Peace and tranquility are within us all. __________________________________________________ Do You Yahoo!? Yahoo! Auctions - buy the things you want at great prices http://auctions.yahoo.com/ Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 04-05-01 (Fractal Number Nine [3]) Date: 04 May 2001 10:27:44 EDT Classic FOTD -- May 04, 2001 (Rating 3) Fractal visionaries and enthusiasts: An unexpected rush job came in today, preventing me from devoting time to a proper fractal search. And since the job is not yet finished, I will have little time to devote to today's fractal notes. The image was created by the formula Z+Z^5+C. With no time to think of a better name, I gave the image the descriptive name "Fractal Number Nine". Being both honest and conservative, I could rate the image no higher than a 3, which equals below average. With a render time of a little over 5 minutes, the parameter file is reasonably fast. An even faster way of seeing the underwhelming image is to download the GIF file from: or from: after giving Paul and Scott a chance to get the image posted. The fractal weather, (I guess weather is fractal), was continued summer-like today, with hot sun, polluted air, and a temperature of 89F (31.5C). All the heat and pollution kept the fractal cats hidden in the shade of the holly trees. It's now time to get busy on other things. Until the next FOTD in 12 hours or so, take care, and become one with your fractals. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Fractal_NumberNine { ; time=0:05:22.42--SF5 on a p200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=ident passes=1 center-mag=-0.213080088333/0.2385427746923/174167.\ 4/1/59.999 params=1/1/1/5/0/0 float=y maxiter=1200 inside=0 logmap=84 periodicity=10 colors=000n6lo7Zq8lt9pvBswCwyNwxXtzfmzqgzz`zzVzzXz\ zYvzYqwZms`hn`dja`gcXccSZdOVfJSfFOgBJh8HhBIjCJkELk\ FLmHMmJOnLInMIpOFqPJqSLsTOsVRtXStYUsYUrYTqXSmVQhVO\ dTMaTMYTOVTPXTRYTRZTS`TTaTVcTVdTXfTYgTZjT`kTamTcnP\ ahMZcIYYFXS8LS18S00S02O36J8BFCFBHJ6LO3JX8JdBJmEJtH\ EgBBa98X62L109000000s00d00R00E000w0qd0`M0J302qMzcF\ vR8cC1M003z0Ez9Cj35R00600B0w60k30a00S00H006000zavd\ LYE39O0z50Pz`gtSYfJOSBFE25000E0z30`00BS0OL0IF0C906\ 302000000zEnf3TE08R0kL0cH0XB0O60H109001000C0I80C30\ 8103000000000H0gC0`80T50M10F008001000fdaOaL5C3BEz3\ 6m00S006dEfY9ZR6SJ2LE0E606000000JhaBTP2FC010qIcJ2C\ 6Lzz00v00g00T00F00100X`0M`0EZ03J00200sn0gcgXTjLIk9\ 8n00sZfwIOz25zOPzIJzEFz99z55z01z30z60z9zzCqzFgzIYz\ LPzOFzR5zT0zX0zZ0za0zd0zgFzgRzg6zgazgLzg3zgRzgJzgC\ zg6zg0zg0zgFzg9zg3zg0zg0zg1zgLzgHzgCzg8zg3zg0zg0zg\ 0zg1zg0zg0zg0zg0zg0zg9zgI } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: DeBow Freed Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 04 May 2001 10:29:17 -0500 Well I don't think it's all that off-point, and can think of several reasons to encourage such rare dialogues on this site:

    a) they're all too INfrequent, frequently stimulating, and *fun*;
    b) they make a great deal more sense, IMHO, than "similar" efforts by those who consider themselves to be philosophers/philosophers  of science, or philosopers AND scientists - who invariably are neither;
    c) the latter have their own philo-whatever discussion sites - have you ever read any of that garbage?.

DBF

Thomas Bennett wrote:

> > Programmer Dude wrote:
> > >
> > > Jim Muth philosophized:
> > >
> > > > ...I pondered about gravity and dark matter.
> The problem is that
> > > > the outer parts of the galaxies are rotating
> too fast to be caused
> > ......................
> >
> >
> > > Just a note: we can't detect it only because it
> does not emit light that
> > > we can see.  Dark matter *could* just be
> ordinary, cold matter, and we
> > > would never be able to see it...from earth.  If
> we can ever get out into
> > > the galaxy and universe, THEN we'd probably have
> no problem detecting
> it.
> > >
> >
> >
> > Aren't we IN the universe?
> > Kathy Roth
> >
I, unfortunately, find these esoteric discussions
somewhat off the point and containing little, if
anything, relevant to the construction of fractals.

    Tom

Peace and tranquility are within us all.

__________________________________________________
Do You Yahoo!?
Yahoo! Auctions - buy the things you want at great prices
http://auctions.yahoo.com/

--------------------------------------------------------------
Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   fractint@lists.xmission.com
Get Commands:   majordomo@lists.xmission.com "help"
Administrator:  twegner@fractint.org
Unsubscribe:    majordomo@lists.xmission.com "unsubscribe fractint"

Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 04 May 2001 10:49:45 -0500 Ricardo M. Forno wrote: > Kathy Roth wrote: >> Programmer Dude wrote: >>> Jim Muth philosophized: >>>> ...I pondered about gravity and dark matter. >>> >>> If we can ever get out into the galaxy and universe, THEN we'd >>> probably have no problem detecting it. >> >> Aren't we IN the universe? > > Aren't we IN a galaxy? "If we can ever get **OUT** **INTO** the galaxy and universe,..." On our little ball of rock, we're snug and safe beneath a protective, concealing blanket of atmosphere....which is encased in a magnetic planetary structure...which is inside the local solar environment. You have to go a long, long way to get **OUT** **INTO** the galactic environment before you can begin to look for dark matter. p.s. Some astronomers have suggested that dark matter might be located in (and I love this term) MACHOS (MAssive Cometary Halo ObjectS). That is, really, really big snowballs. With rocks in them. ;-) -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: DeBow Freed Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 04 May 2001 10:29:17 -0500 Well I don't think it's all that off-point, and can think of several reasons to encourage such rare dialogues on this site:

    a) they're all too INfrequent, frequently stimulating, and *fun*;
    b) they make a great deal more sense, IMHO, than "similar" efforts by those who consider themselves to be philosophers/philosophers  of science, or philosopers AND scientists - who invariably are neither;
    c) the latter have their own philo-whatever discussion sites - have you ever read any of that garbage?.

DBF

Thomas Bennett wrote:

> > Programmer Dude wrote:
> > >
> > > Jim Muth philosophized:
> > >
> > > > ...I pondered about gravity and dark matter.
> The problem is that
> > > > the outer parts of the galaxies are rotating
> too fast to be caused
> > ......................
> >
> >
> > > Just a note: we can't detect it only because it
> does not emit light that
> > > we can see.  Dark matter *could* just be
> ordinary, cold matter, and we
> > > would never be able to see it...from earth.  If
> we can ever get out into
> > > the galaxy and universe, THEN we'd probably have
> no problem detecting
> it.
> > >
> >
> >
> > Aren't we IN the universe?
> > Kathy Roth
> >
I, unfortunately, find these esoteric discussions
somewhat off the point and containing little, if
anything, relevant to the construction of fractals.

    Tom

Peace and tranquility are within us all.

__________________________________________________
Do You Yahoo!?
Yahoo! Auctions - buy the things you want at great prices
http://auctions.yahoo.com/

--------------------------------------------------------------
Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   fractint@lists.xmission.com
Get Commands:   majordomo@lists.xmission.com "help"
Administrator:  twegner@fractint.org
Unsubscribe:    majordomo@lists.xmission.com "unsubscribe fractint"

Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) RE: C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 04 May 2001 20:58:40 -0400 (EDT) At 05:20 AM 5/4/01 -0700, Thomas Bennett wrote: >I, unfortunately, find these esoteric discussions > somewhat off the point and >containing little, if anything, relevant to the >construction of fractals. True, the topic might be more appropriate on the philofractal list, but anyone interested in math and the mathematical aspect of fractals should be equally interested in how the rest of the world works. And, considering the way it has been popularized over the better part of the last century, relativity can hardly still be considered esoteric. FOTD now in work. Jim M. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 05-05-01 (Golden Terraces [6]) Date: 05 May 2001 00:10:21 -0400 (EDT) Classic FOTD -- May 05, 2001 (Rating 6) Fractal visionaries and enthusiasts: As far as I can recall, this is the first time I have needed to post a second version of the same fractal. But I had to do it. Another look at yesterday's pathetic effort convinced me that even the humble rating of 3 was too high. The picture rates closer to a 2, and perhaps even a 1. As stated, today's fractal was created by the same formula as yesterday's. In fact, it's the same image. The only change is that today's version was rendered with the outside=tdis option in effect, which gives the appearance of golden terraces. After minimal consideration, I named the picture "Golden Terraces" and rated it a 6. I chose the name because I saw terraces when I studied the image; I decided on the slightly above average rating of 6 because I kind of like the new version. The parameter file renders in 6-1/2 minutes. A download of the GIF image file is faster, and the GIF image will be available within the hour at: and at: While working with today's image, I discovered a new bug in the latest float-only release of Fractint. I'll track the critter down and post the details in the morning. The fractal weather today continued summer-like, with hot hazy sun and a temperature of 90F (32C). These conditions were a bit too extreme for the intrepid duo of fractal cats, who passed the afternoon lounging on the shaded porch, raising their heads only when they thought they heard a can of food being opened. As all things must eventually come to an end, so must the FOTD for 05-05-01 come to its end. But the 06-05-01 FOTD will appear in only 24 hours, and it is guaranteed to be an improvement. So until then, take care, and watch out for hit-and-run fractals. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Golden_Terraces { ; time=0:06:27.34--SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=mandelbrotmix4 function=ident passes=1 center-mag=-0.213080088333/0.2385427746923/174167.\ 4/1/59.999 params=1/1/1/5/0/0 float=y maxiter=1200 inside=0 outside=tdis periodicity=10 colors=000Q0ZO0dM0kL0qL0wO0qQ0mS2fU6aXBXYFS`KMaOId\ UDfYAic5kg1sn0ys0zw0zz0zy0yt0sn0mi0fc0`Z0UU0LQ0DK0\ AG06C0BD0FF1IG5MH8SICXIG`KKdLOkMSoOXtQ`yQdtOgqMinL\ kiKmfKncIqZHsXGtUFvQFwMDzKCzGBzDAzBAzHGwMMnUUfZ`Yf\ gQmoItwBzz5vw8ssComGmgIiaMfYRcSV`OYYIaVFfSAkQ6nM1s\ K0wH0zaMaytGwsHwsIwsKwsLvsMvsOvsQvsQtqRtqStqUtqVsq\ XsqYsqZsqZg0Hn5Kt8MzCQzGRzIUzKXzMZyOawQdvSgtUksXnq\ YqoZtnawmczkfzigzgiziczkZzmUznQzoKzoGzoIzqMzcd5aa2\ `Z0`Y0YX0VV0UU1RS2OR3MQ3KO5IM6GL7DK8CI8AHA7GB6FC3D\ D2CD0BF0AG08H07I07I0BL0DO0HR0KU0OX0RZ0Va0Yd0ag0dk0\ in0mq0qt0tw0yz0zz1zt8zkGzcOzVXzMdzGnz8wz1zz0zz0zz0\ zw1zv3ys6yo7wnAvkCtgDsdGscIq`KoYMnXQmURmRUkOXiMYgK\ `fHcfGddFfdDfcCgcBgaBiaAi`8k`7k`7kZ6mZ5mY3nY2nX2oX\ 1oV0qV0qV0qHGd5ZU0sK0tL0vL3wL6yL8yLCzLFzLIzLLzLOzL\ SzLVzLYzLVzISyHQtGMqDKmCHgBFcAC`7AX67S55Q33M73KB3H\ D2GH2DL2BO18S17VU0IS0OR0U } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: John Lewis Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 04 May 2001 20:45:53 +0100 We have had from jim Muth >> ... I pondered about gravity and dark matter. And the following points were made > If we can ever get out into the galaxy and universe, THEN we'd= probably have no problem detecting it. > Aren't we IN the universe? > Aren't we IN a galaxy? >"If we can ever get **OUT** **INTO** the galaxy and= universe,..." >On our little ball of rock, we're snug and safe beneath a= protective, concealing blanket of atmosphere.... which is encased in a= magnetic planetary structure... which is inside the local solar= environment. >You have to go a long, long way to get **OUT** **INTO** the= galactic environment before you can begin to look for dark matter. The question then is if we got out of the solar system, how would= we know if we had bumped into some dark matter? Would we in fact= notice, or would it be too diffuse? John Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Tony (Anthony) Hanmer" Subject: (fractint) IFS and L-system anomations... Date: 05 May 2001 15:45:56 +0500 I am seeking a way to make copies of IFS and L-system files of, say, up to 10 lines each, with small changes in 1 or 2 numbers of up to 15 digits each. For instance, with a starting L-system file, ask for changes in the angle of 0.5 degrees (using d), growing larger in one place, smaller in another to compensate, a total of 360 times (= a set of L-system types from 0-180 degrees with all other considerations the same); titles numbered as well, e.g. adh001, adh002, etc. This would allow some kind of overlay of gradually varying output fractals, either into a 3-d set or as an animation of sorts. (Is that all clear?) I would like to be able to do this in either DOS or in a programme with macros like MSWord97. Any ideas...? Could the existing fractal animation programmes do this already or be adapted to do it? Tony Hanmer _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Guy Marson Subject: Re: (fractint) IFS and L-system anomations... Date: 05 May 2001 14:13:28 +0200 At 15:45 05/05/01 +0500, you wrote: >I am seeking a way to make copies of IFS and L-system files of, say, up to >10 lines each, with small changes in 1 or 2 numbers of up to 15 digits each. > For instance, with a starting L-system file, ask for changes in the angle >of 0.5 degrees (using d), growing larger in one place, smaller in another to >compensate, a total of 360 times (= a set of L-system types from 0-180 >degrees with all other considerations the same); titles numbered as well, >e.g. adh001, adh002, etc. This would allow some kind of overlay of >gradually varying output fractals, either into a 3-d set or as an animation >of sorts. (Is that all clear?) I would like to be able to do this in >either DOS or in a programme with macros like MSWord97. Any ideas...? >Could the existing fractal animation programmes do this already or be >adapted to do it? Hi Tony, Is it possible to save this angle in the parameter-File (B-command)? Cheers, Guy Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Guy Marson Subject: Re: (fractint) RE: C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 05 May 2001 15:51:31 +0200 At 20:58 04/05/01 -0400, you wrote: >At 05:20 AM 5/4/01 -0700, Thomas Bennett wrote: > >>I, unfortunately, find these esoteric discussions >> somewhat off the point and >>containing little, if anything, relevant to the >>construction of fractals. > >True, the topic might be more appropriate on the philofractal >list, but anyone interested in math and the mathematical aspect >of fractals should be equally interested in how the rest of the >world works. And, considering the way it has been popularized >over the better part of the last century, relativity can hardly >still be considered esoteric. > "Life is a comedy for those who think and a tragedy for those who feel".... ... so let's fractalize this comedian tragedy. Guy Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: DeBow Freed Subject: Re: (fractint) IFS and L-system anomations... Date: 05 May 2001 09:39:59 -0500 Tony-

There are two sources of code still in print and available from, for example, amazon.com, that I am aware of, that could be adapted as you wish:

1) Meinhardt, H., Prusinkiewicz,P. et al: The Algorithmic Beauty of Shells (2d Ed), c 1998, 248 pgs, .
has an updated CD-ROM enclosed with numerous L-system & branching process programs;

2) Prusinkiewicz, et al: L-Systems, Fractals and Branching Processes,
Springer Lecture Notes in Biomathematics #79, c 1980, 120pgs, ISBN 3-540-97092-4
ends with ~30pgs of straight code in it, but is not very easy going.

As Prusienkiewicz was apparently the popularizer of Lindenmayer systems, look up all his now out of print earlier books and articles, and you'll find many from the 90's with executable code;

Similarly for old Lindenmayer himself, and more recently Meinhardt & pals who has also done books with gorgeous graphics (and documented code) such as The Algorithmic Beauty of Plants w/ enclosed CD-ROMS;

The richest source of code for branching processes in general still lies in the Springer Series Lecture Notes in Biomathematics. Unfortunately, most are out of print - but should be in your Univ library.

Oh, most of the efficient IFS code is patented by and available for $ from a company associated with (I think) Barnsley at Georgia Tech, which may still maintain its website called "IFS, Inc".
 

Good luck.

DeBow Freed

"Tony (Anthony) Hanmer" wrote:

I am seeking a way to make copies of IFS and L-system files of, say, up to
10 lines each, with small changes in 1 or 2 numbers of up to 15 digits each.
  For instance, with a starting L-system file, ask for changes in the angle
of 0.5 degrees (using d), growing larger in one place, smaller in another to
compensate, a total of 360 times (= a set of L-system types  from 0-180
degrees with all other considerations the same); titles numbered as well,
e.g. adh001, adh002, etc.  This would allow some kind of overlay of
gradually varying output fractals, either into a 3-d set or as an animation
of sorts.  (Is that all clear?)  I would like to be able to do this in
either DOS or in a programme with macros like MSWord97.  Any ideas...?
Could the existing fractal animation programmes do this already or be
adapted to do it?

Tony Hanmer
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

--------------------------------------------------------------
Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   fractint@lists.xmission.com
Get Commands:   majordomo@lists.xmission.com "help"
Administrator:  twegner@fractint.org
Unsubscribe:    majordomo@lists.xmission.com "unsubscribe fractint"

Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) Float-only bug report Date: 05 May 2001 10:51:54 EDT I have found an annoying bug in the float-only version of Fractint. The bug is demonstrated by the two attached parameter files. The two files are of the same image, but they were written by different versions of the program. The center coordinates in the first file, which was written by the float-only version, are rounded to 6 places, which at this magnitude causes the wrong image to be drawn. The second file, written by the standard version, draws the correct image. The bug is significant only in this particular magnitude range. At higher magnitudes, the float-only version does not round off the coordinates. At lesser magnitudes, the rounding is insignificant. ======================================================== float-only { ; written by float-only version ; Version 2001 Patchlevel 8 reset=2001 type=formula formulafile=critical.frm formulaname=mandelbrotmix4 function=ident center-mag=-0.213078/0.238549/3905099/1/72.499 params=1/1/1/5/0/0 float=y maxiter=1200 inside=0 outside=tdis periodicity=10 colors=000Q0ZO0dM0kL0qL0wO0qQ0mS2fU6aXBXYFS`KMaOId\ UDfYAic5kg1sn0ys0zw0zz0zy0yt0sn0mi0fc0`Z0UU0LQ0DK0\ AG06C0BD0FF1IG5MH8SICXIG`KKdLOkMSoOXtQ`yQdtOgqMinL\ kiKmfKncIqZHsXGtUFvQFwMDzKCzGBzDAzBAzHGwMMnUUfZ`Yf\ gQmoItwBzz5vw8ssComGmgIiaMfYRcSV`OYYIaVFfSAkQ6nM1s\ K0wH0zaMaytGwsHwsIwsKwsLvsMvsOvsQvsQtqRtqStqUtqVsq\ XsqYsqZsqZg0Hn5Kt8MzCQzGRzIUzKXzMZyOawQdvSgtUksXnq\ YqoZtnawmczkfzigzgiziczkZzmUznQzoKzoGzoIzqMzcd5aa2\ `Z0`Y0YX0VV0UU1RS2OR3MQ3KO5IM6GL7DK8CI8AHA7GB6FC3D\ D2CD0BF0AG08H07I07I0BL0DO0HR0KU0OX0RZ0Va0Yd0ag0dk0\ in0mq0qt0tw0yz0zz1zt8zkGzcOzVXzMdzGnz8wz1zz0zz0zz0\ zw1zv3ys6yo7wnAvkCtgDsdGscIq`KoYMnXQmURmRUkOXiMYgK\ `fHcfGddFfdDfcCgcBgaBiaAi`8k`7k`7kZ6mZ5mY3nY2nX2oX\ 1oV0qV0qV0qHGd5ZU0sK0tL0vL3wL6yL8yLCzLFzLIzLLzLOzL\ SzLVzLYzLVzISyHQtGMqDKmCHgBFcAC`7AX67S55Q33M73KB3H\ D2GH2DL2BO18S17VU0IS0OR0U } standard { ; written by standard version ; Version 2001 Patchlevel 5 reset=2001 type=formula formulafile=critical.frm formulaname=mandelbrotmix4 function=ident center-mag=-0.21307797051286860/+0.238549244665356\ 30/3905099/1/72.499 params=1/1/1/5/0/0 float=y maxiter=1200 inside=0 outside=tdis periodicity=10 colors=000Q0ZO0dM0kL0qL0wO0qQ0mS2fU6aXBXYFS`KMaOId\ UDfYAic5kg1sn0ys0zw0zz0zy0yt0sn0mi0fc0`Z0UU0LQ0DK0\ AG06C0BD0FF1IG5MH8SICXIG`KKdLOkMSoOXtQ`yQdtOgqMinL\ kiKmfKncIqZHsXGtUFvQFwMDzKCzGBzDAzBAzHGwMMnUUfZ`Yf\ gQmoItwBzz5vw8ssComGmgIiaMfYRcSV`OYYIaVFfSAkQ6nM1s\ K0wH0zaMaytGwsHwsIwsKwsLvsMvsOvsQvsQtqRtqStqUtqVsq\ XsqYsqZsqZg0Hn5Kt8MzCQzGRzIUzKXzMZyOawQdvSgtUksXnq\ YqoZtnawmczkfzigzgiziczkZzmUznQzoKzoGzoIzqMzcd5aa2\ `Z0`Y0YX0VV0UU1RS2OR3MQ3KO5IM6GL7DK8CI8AHA7GB6FC3D\ D2CD0BF0AG08H07I07I0BL0DO0HR0KU0OX0RZ0Va0Yd0ag0dk0\ in0mq0qt0tw0yz0zz1zt8zkGzcOzVXzMdzGnz8wz1zz0zz0zz0\ zw1zv3ys6yo7wnAvkCtgDsdGscIq`KoYMnXQmURmRUkOXiMYgK\ `fHcfGddFfdDfcCgcBgaBiaAi`8k`7k`7kZ6mZ5mY3nY2nX2oX\ 1oV0qV0qV0qHGd5ZU0sK0tL0vL3wL6yL8yLCzLFzLIzLLzLOzL\ SzLVzLYzLVzISyHQtGMqDKmCHgBFcAC`7AX67S55Q33M73KB3H\ D2GH2DL2BO18S17VU0IS0OR0U } ===================================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Tim Wegner Subject: (fractint) What is on topic or off topic Date: 05 May 2001 12:22:48 -0600 Recently several of you have been concerned about whether some of the recent discussion has been on or off topic for this list. It is important to keep messages on topic. The topic is fractals and fractint. Keeping messages on topic is a courtesy to all the list members who are receiving all the mail on this list, and who subscribed because they are interested in the topic. This is really an issue of mindfulness that is needed when posting. Before pressing the button, just ask yourself if your post is really appropriate for this list. I should add that the topic of fractals is indeed broad. It certainly covers some aspects of mathematics, philosophy, astronomy, and speculation about the physical world. I not want to suggest that some of the recent threads were necessarily inappropriate, though it is probably true that some of the posts in those threads had indeed wandered far off topic. I ask only that when you branch into those related fields, you be mindful to keep the discussion related somewhat to our topic, at least after a post or two. Here's an example of a related topic that I think is fine for this list. Here's an animated zoom made from NASA imagery that reminds me a lot of animated zooms I have made with fractint. You will need software that reads MPEG files to enjoythis (e.g. Windows Media Player). It's kind of a long URL, you might need to unwrap it. This one zooms from the whole planet to Fisherman's Wharf. www.gsfc.nasa.gov/GSFC/EARTH/imaging/SanFrancisco_zoom_in.mpeg Tim Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: DeBow Freed Subject: Addendum to: Re: (fractint) IFS and L-system anomations... Date: 05 May 2001 14:39:11 -0500 Tony-

The specific degree/branch-related question you ask is dealt with in C in the following book, whose in-print/outofprint status I don't know:

Rozenberg,G & Salomaa,A (Eds): The Book of L, Springer-Verlag, c1985, 492p,
    ISBN 3-540-16022-1 and 0-387-16022-1.

DBF

DeBow Freed wrote:

Tony-

There are two sources of code still in print and available from, for example, amazon.com, that I am aware of, that could be adapted as you wish:

1) Meinhardt, H., Prusinkiewicz,P. et al: The Algorithmic Beauty of Shells (2d Ed), c 1998, 248 pgs, .
has an updated CD-ROM enclosed with numerous L-system & branching process programs;

2) Prusinkiewicz, et al: L-Systems, Fractals and Branching Processes,
Springer Lecture Notes in Biomathematics #79, c 1980, 120pgs, ISBN 3-540-97092-4
ends with ~30pgs of straight code in it, but is not very easy going.

As Prusienkiewicz was apparently the popularizer of Lindenmayer systems, look up all his now out of print earlier books and articles, and you'll find many from the 90's with executable code;

Similarly for old Lindenmayer himself, and more recently Meinhardt & pals who has also done books with gorgeous graphics (and documented code) such as The Algorithmic Beauty of Plants w/ enclosed CD-ROMS;

The richest source of code for branching processes in general still lies in the Springer Series Lecture Notes in Biomathematics. Unfortunately, most are out of print - but should be in your Univ library.

Oh, most of the efficient IFS code is patented by and available for $ from a company associated with (I think) Barnsley at Georgia Tech, which may still maintain its website called "IFS, Inc".
 

Good luck.

DeBow Freed

"Tony (Anthony) Hanmer" wrote:

I am seeking a way to make copies of IFS and L-system files of, say, up to
10 lines each, with small changes in 1 or 2 numbers of up to 15 digits each.
  For instance, with a starting L-system file, ask for changes in the angle
of 0.5 degrees (using d), growing larger in one place, smaller in another to
compensate, a total of 360 times (= a set of L-system types  from 0-180
degrees with all other considerations the same); titles numbered as well,
e.g. adh001, adh002, etc.  This would allow some kind of overlay of
gradually varying output fractals, either into a 3-d set or as an animation
of sorts.  (Is that all clear?)  I would like to be able to do this in
either DOS or in a programme with macros like MSWord97.  Any ideas...?
Could the existing fractal animation programmes do this already or be
adapted to do it?

Tony Hanmer
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

--------------------------------------------------------------
Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   fractint@lists.xmission.com
Get Commands:   majordomo@lists.xmission.com "help"
Administrator:  twegner@fractint.org
Unsubscribe:    majordomo@lists.xmission.com "unsubscribe fractint"

using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint"
Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jonathan Osuch" Subject: Re: (fractint) Float-only bug report Date: 05 May 2001 16:56:56 -0500 Jim, > I have found an annoying bug in the float-only version of > Fractint. The bug is demonstrated by the two attached parameter > files. The two files are of the same image, but they were > written by different versions of the program. Can you recall the exact steps you took to get from the standard version image to the float only version image? I can't get there (using the float only version) from the standard version PAR or a GIF made from it. It may also help if you sent me your sstools.ini file used with the float only version. Thanks. Jonathan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Thomas Bennett Subject: Re: (fractint) RE: C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 05 May 2001 15:57:30 -0700 (PDT) --- Guy Marson wrote: > >True, the topic might be more appropriate on the > philofractal > >list, but anyone interested in math and the > mathematical aspect > >of fractals should be equally interested in how the > rest of the > >world works. And, considering the way it has been > popularized > >over the better part of the last century, > relativity can hardly > >still be considered esoteric. I see no reason why an interest in fractals automatically condemns me to an interest in how the rest of the world works. Now I am posting off topic. Tom. __________________________________________________ Do You Yahoo!? Yahoo! Auctions - buy the things you want at great prices http://auctions.yahoo.com/ Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) Re: Float-only bug report Date: 05 May 2001 20:11:20 EDT Johnathan wrote: >Can you recall the exact steps you took to get from the standard version >image to the float only version image? I can't get there (using the float >only version) from the standard version PAR or a GIF made from it. It may >also help if you sent me your sstools.ini file used with the float only >version. Thanks. I had to temporarily rename the two fractint.exe files to shift back and forth from float-only to standard. To reproduce the bug, boot the float-only version of Fractint and run the parameter file attached to the bottom of this letter. The file was written by the full version with integer math. Then, still using the float-only version, save a new parameter file of the just finished image. Next run the parameter file that you just saved and compare the two images. The new image will be offset by about half a screen width. The problem seems to be that the float-only version waits until too great a magnitude is reached before it stops rounding the center coordinates to 6 places. The bug is very subtle and affects only a small magnitude range, which is why I did not notice it until I began working with the "Golden Terraces" image, which happens to lie in that narrow range. Here is my sstools.ini file, which gets me into the MandelbrotMix4 formula and draws a blank black screen. I doubt that the .ini file is involved. I hope this info helps. Jim M. START SSTOOLS.INI FILE========================== TYPE=formula FLOAT=yes FORMULAFILE=critical.frm FORMULANAME=MandelbrotMix4 MAXITER=100 PASSES=g INSIDE=0 PERIODICITY=10 SYMMETRY=none PARAMS=1/999999999/1/1/1/99999 FUNCTION=recip ; BAILOUT=25 LOGMAP=yes FASTRESTORE=yes VIDEO=sf5 ASKVIDEO=no SAVETIME=25 MATHTOLERANCE=/0.18 DEBUGFLAG=920 TEXTSAFE=save END SSTOOLS.INI FILE============================ START PARAMETER FILE============================ standard { ; parameters by standard version ; Version 2001 Patchlevel 5 reset=2001 type=formula formulafile=critical.frm formulaname=mandelbrotmix4 function=ident center-mag=-0.21307797051286860/+0.238549244665356\ 30/3905099/1/72.499 params=1/1/1/5/0/0 float=y maxiter=1200 inside=0 outside=tdis periodicity=10 colors=000Q0ZO0dM0kL0qL0wO0qQ0mS2fU6aXBXYFS`KMaOId\ UDfYAic5kg1sn0ys0zw0zz0zy0yt0sn0mi0fc0`Z0UU0LQ0DK0\ AG06C0BD0FF1IG5MH8SICXIG`KKdLOkMSoOXtQ`yQdtOgqMinL\ kiKmfKncIqZHsXGtUFvQFwMDzKCzGBzDAzBAzHGwMMnUUfZ`Yf\ gQmoItwBzz5vw8ssComGmgIiaMfYRcSV`OYYIaVFfSAkQ6nM1s\ K0wH0zaMaytGwsHwsIwsKwsLvsMvsOvsQvsQtqRtqStqUtqVsq\ XsqYsqZsqZg0Hn5Kt8MzCQzGRzIUzKXzMZyOawQdvSgtUksXnq\ YqoZtnawmczkfzigzgiziczkZzmUznQzoKzoGzoIzqMzcd5aa2\ `Z0`Y0YX0VV0UU1RS2OR3MQ3KO5IM6GL7DK8CI8AHA7GB6FC3D\ D2CD0BF0AG08H07I07I0BL0DO0HR0KU0OX0RZ0Va0Yd0ag0dk0\ in0mq0qt0tw0yz0zz1zt8zkGzcOzVXzMdzGnz8wz1zz0zz0zz0\ zw1zv3ys6yo7wnAvkCtgDsdGscIq`KoYMnXQmURmRUkOXiMYgK\ `fHcfGddFfdDfcCgcBgaBiaAi`8k`7k`7kZ6mZ5mY3nY2nX2oX\ 1oV0qV0qV0qHGd5ZU0sK0tL0vL3wL6yL8yLCzLFzLIzLLzLOzL\ SzLVzLYzLVzISyHQtGMqDKmCHgBFcAC`7AX67S55Q33M73KB3H\ D2GH2DL2BO18S17VU0IS0OR0U } END PARAMETER FILE============================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) Re: C-FOTD 28-04-01 Date: 05 May 2001 20:17:18 EDT Tom Bennett wrote: >I see no reason why an interest in fractals >automatically condemns me to an interest in how the >rest of the world works. Being interested in fractals certainly does not condemn anyone to an interest in the world. But since when has an interest in the world around us been a condemnation? FOTD in 3 hours or so. Jim M. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mike Traynor Subject: Re: (fractint) No hard feelings Date: 05 May 2001 22:30:14 -0400 Zorba, > Anyway. On a slightly different note, it's pretty unlikely that I'll do the > re-rendering with Fractint, for multiple reasons - no built-in antialiasing, > for example, and it multitasks pretty badly with Windows. If I can figure > out how to duplicate the exact images in Ultrafractal (I haven't even gone > back to see the differences yet, actually) I might try, but considering that > one complaint was the color banding (which I can't imagine how it could > possibly be *worse* on UF than Fractint) Why imagine? I did Swarm027 and Swarm018 in Fractint disk/video mode at 1600x1200 under W98 and they took about 35 and 18 minutes (PIII/600) respectively and didn't cause problems doing it. The differences are obvious. Having the benefit over you that I have actually seen the fractint images at 1600x1200, I'd say they don't need anti-aliasing and since it destroys the textures that are a feature of at least those two images, anti-aliasing isn't a benefit. You may or may not like the texture Sylvie has brought out, but to rely on your imagination when you could see for yourself in very little time is odd indeed. Try them. You might like them. > and the antialiasing (which I > consider totally incomprehensible from an artistic standpoint - if anything, > it makes it *more* detailed, IMHO It doesn't make an image more detailed. It smooths things out, so it actually removes detail - whether that detail is real or artifice and whether it is wanted or not are other matters. If you do the image in fractint you'll see that either UF or the anti-aliasing has removed the texture that is an interesting feature of Swarm027 and Swarm018. Mike Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 06-05-01 (A Hazy Mandelbrot [4]) Date: 05 May 2001 23:01:39 -0400 (EDT) Classic FOTD -- May 06, 2001 (Rating 4) Fractal visionaries and enthusiasts: Though it takes over one hour to render, today's fractal was found with little effort. In fact, it was found with perhaps too little effort, which accounts for the inglorious rating of 4. The image shows a midget in a remote valley of a twisted minibrot, lying in the chaos near the western shoreline of a remote part of the Z^2.01+C Mandeloid. I named the image "A Hazy Mandelbrot". The name is fairly descriptive of the hazy appearance of the territory surrounding the center midget, especially when viewed from a distance. The texture of the haze reflects the nature of the chaos in the area of the parent fractal where today's image is located. As I watched the image slowly take shape, I wondered about the infinite logarithmic spiral, of which today's scene is an infinitesimal part. Of what dimension is it? My first guess would be that it is five-dimensional, since every twist is four- dimensional. But I'm not at all sure that my guess is right. In fact, the spiral might be of a fractional dimension. The render time of over one hour almost demands a download of the GIF image. But before going for the download, give Paul and Scott a chance to render and post the GIF image file. That file will be available on the Web at: and at: The fractal weather today was partly cloudy and pleasant. The temperature of 83F (28C) was judged purrfect by the cats, who lounged and purred in the intermittent sun for a good part of the afternoon. BTW, the time is getting closer when the fractal cats' pictures will be available, and perhaps my own as well. For now and until next time, take care, and it's interesting to be interested. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ A_Hazy_Mandelbrot { ; time=1:10:00.30--SF5 on a p200 reset=2001 type=formula formulafile=branchct.frm formulaname=MandelbrotBC1 function=floor passes=1 center-mag=-1.243321752587454/+0.01558682750444/1.\ 717303e+007/1/-67.5 params=2.01/0/-20/0 float=y maxiter=15000 inside=0 logmap=-1145 periodicity=10 colors=000jgZkeVkcRlbNm`JmZFnXBnV9nW8nX7nX7nY6nZ6n\ Z5n_5n`4n`4ykDvgJtdOraUpZZnVdlSijPohMtfJyeMxdOxcRx\ bTwaWw`Yw_`vZbvYevXguWjuVluUotTqtSttRvtVnvYfwaZydS\ zfNthJniFhkAbm6Xn2RcASUHTMMWKOUIPSGQQERPCSNATL8UJ6\ TE7VI7XL7ZP7`S7bW8dZ8fb8he8ji8ll8mo7hk7ch7_e7Va7RZ\ 7MW7IS7DP65G79M7DR8HW8L`9Pe9TjAXoA`tAcy9aa8`F9aE9b\ EAcDAdDAeCBfCBgBChBCiACjADk9Dl9Em8En8Bm6En8Gn9JnBL\ nCOnDQnFTnGVnHYnJ_nKbnLdnNgnOhrNinPijQifSibTiZViWW\ jSXjOZjK_jGajCbl6bj9ciCchFdgIdfLeeOedRfcUfbXga_g`a\ g_`hZ`hY_hY_hX_iWZiWZiVZiUYjUYjTXjSXjSXkRWkQWkQWkS\ ZeTa_VcUWfOYhIZkCcp6_m7Wj8Sg9Od9LaAHZBDWB9TC5QD0G1\ 2OD4WP6c`8kl9sw8pr8mn8jj7ge7da7aY7ZU6WP6TL6QH5NC5K\ 85H45F09E2CE3GE4JE5NE6QE8UE9XEA_DBcDCfDEjDFmDGqDHt\ DIwDJuGHsJFqMDoOBmR9kU7hX1jW5kW8lVBmVFnUIpULqTOrTS\ sSVtSYvR`wRdxQgyQjzQmvdWssFeTAdXGd_LdbRcbXdeWegVei\ VfkUgmTeyMgoTif_kXf`b_iib } frm:MandelbrotBC1 { ; by several Fractint users e=p1, a=imag(p2)+100 p=real(p2)+PI q=2*PI*fn1(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z| Subject: Re: (fractint) What is on topic or off topic Date: 05 May 2001 22:06:04 -0700 (PDT) i'd like to know (1) if there are more like this, (2) how they did it (a series of increasingly-focused photos taken within the same minute or two, or ?), and (3) if that's fisherman's wharf (pier 39?) underneath all that (i'm pretty sure that's where the zoom ends, with ghirardelli square just a bit south(west?) of the wharf... the clouds don't move, nor do the ships, so it has me wondering... you're right... the feel is similar to zooming animation with fractint, right down to some of the pixelation... :) --- Tim Wegner wrote: > Here's an animated zoom made from NASA imagery that reminds me a > lot of animated zooms I have made with fractint. You will need > software > that reads MPEG files to enjoythis (e.g. Windows Media Player). It's > kind > of a long URL, you might need to unwrap it. > > This one zooms from the whole planet to Fisherman's Wharf. > > www.gsfc.nasa.gov/GSFC/EARTH/imaging/SanFrancisco_zoom_in.mpeg > > Tim > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" __________________________________________________ Do You Yahoo!? Yahoo! Auctions - buy the things you want at great prices http://auctions.yahoo.com/ Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Tony (Anthony) Hanmer" Subject: Re: (fractint) IFS and L-system anomations... Date: 06 May 2001 10:53:41 +0500 This is a multi-part message in MIME format. ------=_NextPart_000_24fc_114b_403 Content-Type: text/plain; format=flowed Thanks for the advice so far. The L-system info is particularly interesting. But I'll now rephrase what I'm looking for: A way of copying and incrementing the digits of a small sample of TEXT, to a set degree, a set number of times. Forget the L-system or IFS formats; I'm concerned only with simple text files, as it is these - suffixed .l or .ifs - which will be interpreted by Fractint and produce the necessary fractals. (I will investigate the various books suggested, as I do want to know more about L-systems in general.) Any ideas? Tony Hanmer _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. ------=_NextPart_000_24fc_114b_403 Content-Type: message/rfc822 From owner-fractint@lists.xmission.com Sat May 05 12:27:09 2001 Received: from [198.60.22.7] by hotmail.com (3.2) with ESMTP id MHotMailBCBD9EEF00A440043151C63C1607D1BD0; Sat May 05 12:26:42 2001 Received: from domo by lists.xmission.com with local (Exim 2.12 #2) id 14w7gm-00003d-00 for fractint-gooutt@lists.xmission.com; Sat, 5 May 2001 13:26:00 -0600 Message-ID: <3AF456DF.C48E39B4@airmail.net> Organization: The BMC Group / USA X-Mailer: Mozilla 4.7 [en]C-NSCPCD (Win98; U) X-Accept-Language: en MIME-Version: 1.0 References: <3AF410BF.C5D9E539@airmail.net> Content-Type: text/html; charset=us-ascii Content-Transfer-Encoding: 7bit Sender: owner-fractint@lists.xmission.com Precedence: bulk Reply-To: fractint@lists.xmission.com Tony-

The specific degree/branch-related question you ask is dealt with in C in the following book, whose in-print/outofprint status I don't know:

Rozenberg,G & Salomaa,A (Eds): The Book of L, Springer-Verlag, c1985, 492p,
    ISBN 3-540-16022-1 and 0-387-16022-1.

DBF

DeBow Freed wrote:

Tony-

There are two sources of code still in print and available from, for example, amazon.com, that I am aware of, that could be adapted as you wish:

1) Meinhardt, H., Prusinkiewicz,P. et al: The Algorithmic Beauty of Shells (2d Ed), c 1998, 248 pgs, .
has an updated CD-ROM enclosed with numerous L-system & branching process programs;

2) Prusinkiewicz, et al: L-Systems, Fractals and Branching Processes,
Springer Lecture Notes in Biomathematics #79, c 1980, 120pgs, ISBN 3-540-97092-4
ends with ~30pgs of straight code in it, but is not very easy going.

As Prusienkiewicz was apparently the popularizer of Lindenmayer systems, look up all his now out of print earlier books and articles, and you'll find many from the 90's with executable code;

Similarly for old Lindenmayer himself, and more recently Meinhardt & pals who has also done books with gorgeous graphics (and documented code) such as The Algorithmic Beauty of Plants w/ enclosed CD-ROMS;

The richest source of code for branching processes in general still lies in the Springer Series Lecture Notes in Biomathematics. Unfortunately, most are out of print - but should be in your Univ library.

Oh, most of the efficient IFS code is patented by and available for $ from a company associated with (I think) Barnsley at Georgia Tech, which may still maintain its website called "IFS, Inc".
 

Good luck.

DeBow Freed

"Tony (Anthony) Hanmer" wrote:

I am seeking a way to make copies of IFS and L-system files of, say, up to
10 lines each, with small changes in 1 or 2 numbers of up to 15 digits each.
  For instance, with a starting L-system file, ask for changes in the angle
of 0.5 degrees (using d), growing larger in one place, smaller in another to
compensate, a total of 360 times (= a set of L-system types  from 0-180
degrees with all other considerations the same); titles numbered as well,
e.g. adh001, adh002, etc.  This would allow some kind of overlay of
gradually varying output fractals, either into a 3-d set or as an animation
of sorts.  (Is that all clear?)  I would like to be able to do this in
either DOS or in a programme with macros like MSWord97.  Any ideas...?
Could the existing fractal animation programmes do this already or be
adapted to do it?

Tony Hanmer
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at
http://www.hotmail.com.

--------------------------------------------------------------
Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   fractint@lists.xmission.com
Get Commands:   majordomo@lists.xmission.com "help"
Administrator:  twegner@fractint.org
Unsubscribe:    majordomo@lists.xmission.com "unsubscribe fractint"

using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint"
Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------=_NextPart_000_24fc_114b_403-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Scott D. Boyd" Subject: Re: (fractint) What is on topic or off topic Date: 06 May 2001 01:36:17 -0500 caren, For more of these types of animations and other satellite pictures of our planet, go to: http://www.gsfc.nasa.gov/GSFC/EARTH/imaging/landsat.htm They also have a description on this page on how they do the zoom-ins. The home page for the site is at: http://www.gsfc.nasa.gov/ The link for the first URL mentioned above is below the second picture down the middle column. It's a great site if you have a fast connection! Scott On Sunday 06 May 2001 00:06, caren wrote: > i'd like to know (1) if there are more like this, (2) how they did it > (a series of increasingly-focused photos taken within the same minute > or two, or ?), and (3) if that's fisherman's wharf (pier 39?) > underneath all that (i'm pretty sure that's where the zoom ends, with > ghirardelli square just a bit south(west?) of the wharf... > > the clouds don't move, nor do the ships, so it has me wondering... > > you're right... the feel is similar to zooming animation with > fractint, right down to some of the pixelation... :) > > --- Tim Wegner wrote: > > Here's an animated zoom made from NASA imagery that reminds me a > > lot of animated zooms I have made with fractint. You will need > > software > > that reads MPEG files to enjoythis (e.g. Windows Media Player). It's > > kind > > of a long URL, you might need to unwrap it. > > > > This one zooms from the whole planet to Fisherman's Wharf. > > > > www.gsfc.nasa.gov/GSFC/EARTH/imaging/SanFrancisco_zoom_in.mpeg > > > > Tim > > > > -------------------------------------------------------------- > > Thanks for using Fractint, The Fractals and Fractint Discussion List > > Post Message: fractint@lists.xmission.com > > Get Commands: majordomo@lists.xmission.com "help" > > Administrator: twegner@fractint.org > > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > > __________________________________________________ > Do You Yahoo!? > Yahoo! Auctions - buy the things you want at great prices > http://auctions.yahoo.com/ > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" -- sdboyd56@swbell.net http://sdboyd.dyndns.org/~sdboyd/ I always wanted to be a procrastinator, but I never got around to it. -- Unknown Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jonathan Osuch" Subject: Re: (fractint) Re: Float-only bug report Date: 06 May 2001 12:27:33 -0500 Jim, > The problem seems to be that the float-only version waits until > too great a magnitude is reached before it stops rounding the > center coordinates to 6 places. The bug is very subtle and > affects only a small magnitude range, which is why I did not > notice it until I began working with the "Golden Terraces" > image, which happens to lie in that narrow range. The coordinates aren't being rounded until they are written to the PAR file. Without your sstools.ini file I never would have found this bug. I usually work at 1024x768 or 800x600. This bug only show up if you create the PAR entry at 640x480 (and probably lower). The interim solution is to create your PARs with the floating-only version using a higher screen resolution. I have a brute force fix, but I need to study the code more to understand why this only happens with the float-only version. Good catch, thanks. Jonathan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jonathan Osuch" Subject: (fractint) Fractint patch 20.1.09 Date: 06 May 2001 20:48:29 -0500 Patch 9 is now on the developer's web site. www.fractint.org What's new: Fixed evolver bug that occurred when some formula functions were evolved and others were not being evolved. Fixed a bug in the float-only version which truncated the image coordinates when saved to a PAR. The reason for the small patch is because the change for the float-only version has to be applied to the float-only source by hand. I didn't want it to get lost in a big patch. Jonathan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mike Traynor Subject: Re: (fractint) Fractint patch 20.1.09 Date: 07 May 2001 00:10:24 -0400 I have a problem with the latest Fractint patch and with 20.1.08. The SF4-SF-9 video modes work with 20.1.07 and earlier models but yield gobbledygook (like several superimposed images at the top of the screen) with the 08 and 09 versions. Anybody know what is wrong? Mike Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mike Traynor Subject: Re: (fractint) Fractint patch 20.1.09 Date: 07 May 2001 00:15:37 -0400 Mike Traynor wrote: Oops. > I have a problem with the latest Fractint patch and with 20.1.08. The SF4-SF-9 > video modes work with 20.1.07 and earlier models but yield gobbledygook (like > several superimposed images at the top of the screen) with the 08 and 09 versions. Those are the SF4-SF9 modes in the fractint.cfg that is in the distribution zip for 20.1.7 to 20.1.9 (and probably earlier). Anybody know what is wrong? Mike Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jean-Pierre Louvet" Subject: (fractint) New pages and new address Date: 07 May 2001 11:46:08 +0200 Hi all My web site was sleeping for a long time. There are now 4 new pages (p. 26, 27, 28, 29) of images made with Ultra Fractal. Please note the new address of my site below in the sig. Note also that the addresses of the mirrors for the fractal contests are now: http://fractals.iuta.u-bordeaux.fr/contest98/ http://fractals.iuta.u-bordeaux.fr/contest99/ http://fractals.iuta.u-bordeaux.fr/contest2k/ Thank you for all of you having links to my pages of to this mirrors to update them. And, if something is wrong (links which may not work...), let me informed. All the best. J.P. Louvet | Phone : (33)05-56-84-58-35 IUT Universite Bordeaux 1 | 33405 Talence CEDEX France | email : louvet@hse.iuta.u-bordeaux.fr Fractales sur serveur Web IUT Universite Bordeaux 1 : http://fractals.iuta.u-bordeaux.fr Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Zorba the Hutt" Subject: Re: (fractint) No hard feelings Date: 07 May 2001 08:25:56 -0700 > > Why imagine? I did Swarm027 and Swarm018 in Fractint disk/video mode at 1600x1200 > under W98 and they took about 35 and 18 minutes (PIII/600) respectively and > didn't cause problems doing it. The differences are obvious. Having the benefit > over you that I have actually seen the fractint images at 1600x1200, I'd say they > don't need anti-aliasing and since it destroys the textures that are a feature of > at least those two images, anti-aliasing isn't a benefit. You may or may not like > the texture Sylvie has brought out, but to rely on your imagination when you could > see for yourself in very little time is odd indeed. Try them. You might like > them. > possibly because I didn't actually have a copy of Fractint around due to a system reinstall, possibly because I don't have a PIII/600, I have a Celeron 266 running at 400, possibly because it's my main computer, Fractint doesn't time-share worth talking about, and I have other things I need to be doing. Really, I don't appreciate the tone of this one at all. > It doesn't make an image more detailed. It smooths things out, so it actually > removes detail - whether that detail is real or artifice and whether it is > wanted or not are other matters. If you do the image in fractint you'll see > that either UF or the anti-aliasing has removed the texture that is an interesting > feature of Swarm027 and Swarm018. I hate to sound condescending here, but I wasn't in a good mood *before* I read this e-mail, so, whatever. Do you actually know what anti-aliasing does? It doesn't remove detail, it doesn't smooth things out. It does more calculations on that pixel to determine more exactly what the color is. Yes, you could make a case for it "removing detail", but only if that precise point was important without caring what was around it. Which generally humans don't. It's equivalent to making a higher resolution picture and sampling it down, so the data of nine pixels is fit into one pixel - in fact, that's exactly what Fractint anti-aliasing is, rendering it at a really really high resolution and using something like Photoshop to make it smaller. UF has it built-in and has a far more intelligent algorithm it can use, which is why I like it for antialiased stuff. And so, okay, I went and got a copy of Fractint, and installed it, and found the formula and all, and, yes, there is a strange static on the side. Which I definitely don't understand, because, to me at least, it doesn't look like it's actually part of the fractal. It looks like a rounding error. (This is the same thing I noticed with Jim Muth's original, in fact.) Can anyone confirm or deny this? Zooming in, I notice that it stays pure static. The UF version doesn't have the static at all - it looks smooth. While I realize that fractals do degenerate into chaos, this isn't chaos, this is random-variation-around-a-center - it's quite clear that the top part of Swarm27 is basically-green while the middle part (for example) is basically-beige, with it shifting smoothly between them, except for a random color+-50 or so on every single pixel. This just plain doesn't look right to me, especially considering that UF generates the identical image minus the static . . . Well, anyone know what's going on here? -Zorba Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 07-05-01 (Spiralesque [4]) Date: 07 May 2001 10:24:02 EDT Classic FOTD -- May 07, 2001 (Rating 4) Fractal visionaries and enthusiasts: Being forced into too much yard work, (Picking up one stick is too much.) I found little time for fractal fun. But in the end the yard work was worth it. The yard now looks better, and the fractal, which I eventually did get to, rates a 4, which is not too bad. The formula behind the image is -1.5(Z^1.2)+1.5(Z^1.3)+C, a modest expression that would be expected to do little, and indeed does but little. But that little that the formula does manage to do holds at least a few interesting things. Today's unusual spiral is one of those things. The spiral is unusual in that its 8 arms are unusually fragmented, and not at all the smoothly blended things that would be expected. While studying and trying to color the image, I felt the impression of something vaguely sinister, and considered a corresponding name, but being unable to pin down the cause of my impression, I settled on the neutral name, "Spiralesque". The parameter file renders in just over 9 minutes. The GIF file will be available for download in an hour or so at: and at: The fractal weather today, with its partly cloudy skies and temperature of 65F (18C), was perfect for yard work. It was also perfect for fractal cats, but the intrepid duo was annoyed by the activity, and spent most of the day indoors. I eased their frustration with a treat of tuna. It's now the middle of the morning and time for other work. Until next FOTD, which will appear in 12 hours or so, take care, and don't overwork. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Spiralesque { ; time=0:09:10.69--SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=ident passes=1 center-mag=+1.936911287737238/+7.881112847818978/7\ .861229e+008/1/-147.5 params=-1.5/1.2/1.5/1.3/0/800 float=y maxiter=900 inside=0 logmap=174 periodicity=10 colors=000P00mmPmmHmmJmkLmiLmgNkeNedP`bPV`RNZTHXTC\ VV6TV0RX0PX00K0AK0GN6ACH42T00d00iA0mNHq``ukoxtzzzz\ xwzuuzqqzkixgbsdVk`NeeRkiVomXss`vvbzzezzizzkzzozzq\ zzuzzvzzxzzzzzzzuzzmzzezzZzzPzzHzzAzz2zz0zz0zz0zz0\ zz0zz2zz8zzGzzNxzVuz`oxgkvoguvdqz`ozXkzTizPgzLkzHm\ uGqkCsbAsV6pL2mC0m20m00m00m00m00m04m0Ao0Hq0Ns4VoAb\ kEgeJobNuZTzVXzPbzLezHizEgzLezTdz`bzg`xoZsvXmzVgzV\ bzX`zXZzXXzXVzXVzXTzXRzZPzZNzZNzZLzZJzZHzZGzZGzgCz\ qAzz6zz4zz0zs0zk0vd0uX0qR0oJ0kC0i40e00d00b00V20N80\ GE8AJH2PP0VZ0`e0Pb0G`H6ZZC``G`bJbdNbeRbgVdiZdkbdmg\ eokeqogssguvgvzixzizzizzeuzdqx`muZiqVeoTbkPZgNVeJR\ bHNZEJXCGVALV8PT8VT6ZR4dR4gR2mP0qP0vN0zN0zL0zL0zL0\ zP0zT6zXCz`HzdNxeTsiZomdkqikuouvszkvz`xzPzzLvzHuzG\ szCqz8oz6mz2kz0kz0kz0kz0kz0kz6kzEkzLkzTmz`ozgqzosz\ suzuvzvxzxzuzzmzzezzZzzRzzJzzCzz4zz0zz0zz0zz0zz0zz\ 4zzCuzJqzRmzXgzddzkZzsVzz } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jean-Pierre Louvet" Subject: (fractint) Fractal art FAQ: new version, new address Date: 07 May 2001 17:22:09 +0200 Hi all, Version 1.4 of the Fractal Art FAQ, updated 05.07.2001, is at http://fractals.iuta.u-bordeaux.fr/f-art-faq/ (replaces the previous address) and thanks to Damien it is always at www.fractalus.com/fractal-art-faq/ Thank you to update your links if you use the French address. Best regards. J.P. Louvet | Phone : (33)05-56-84-58-35 IUT Universite Bordeaux 1 | 33405 Talence CEDEX France | email : louvet@hse.iuta.u-bordeaux.fr Fractales sur serveur Web IUT Universite Bordeaux 1 : http://fractals.iuta.u-bordeaux.fr Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "James R. McKenzie" Subject: Re: (fractint) Fractint patch 20.1.09 Date: 07 May 2001 11:50:27 -0400 I got the same thing with 20.1.08. All I got was about an inch of the image at the top of the screen (17 inch Mag Innovison 770DX running fractint @ 1024x1280) believe it or not my Vid cards and old ATI All In Wonder Pro hard-wired @ 8 meg of RAM. Fractint 20.1.15 runs just fine like this but anything newer won't. Oh well, for what ever it's worth that's my spare change thrown in. T H A N K Y O U James R. McKenzie jimmckenzie@earthlink.net ----- Original Message ----- Sent: Monday, May 07, 2001 12:10 AM > I have a problem with the latest Fractint patch and with 20.1.08. The SF4-SF-9 > video modes work with 20.1.07 and earlier models but yield gobbledygook (like > several superimposed images at the top of the screen) with the 08 and 09 versions. > > Anybody know what is wrong? > > Mike > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "James R. McKenzie" Subject: Re: (fractint) Fractint patch 20.1.09 Date: 07 May 2001 11:50:27 -0400 I got the same thing with 20.1.08. All I got was about an inch of the image at the top of the screen (17 inch Mag Innovison 770DX running fractint @ 1024x1280) believe it or not my Vid cards and old ATI All In Wonder Pro hard-wired @ 8 meg of RAM. Fractint 20.1.15 runs just fine like this but anything newer won't. Oh well, for what ever it's worth that's my spare change thrown in. T H A N K Y O U James R. McKenzie jimmckenzie@earthlink.net ----- Original Message ----- Sent: Monday, May 07, 2001 12:10 AM > I have a problem with the latest Fractint patch and with 20.1.08. The SF4-SF-9 > video modes work with 20.1.07 and earlier models but yield gobbledygook (like > several superimposed images at the top of the screen) with the 08 and 09 versions. > > Anybody know what is wrong? > > Mike > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jonathan Osuch" Subject: Re: (fractint) Fractint patch 20.1.09 Date: 07 May 2001 20:19:55 -0500 Mike, > I have a problem with the latest Fractint patch and with 20.1.08. The SF4-SF-9 > video modes work with 20.1.07 and earlier models but yield gobbledygook (like > several superimposed images at the top of the screen) with the 08 and 09 versions. > Anybody know what is wrong? What video card are you using and do you know which version of the VESA vbe it is using? Jonathan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mike Traynor Subject: Re: (fractint) Fractint patch 20.1.09 Date: 07 May 2001 22:27:21 -0400 Jonathan , > > I have a problem with the latest Fractint patch and with 20.1.08. The > SF4-SF-9 > > video modes work with 20.1.07 and earlier models but yield gobbledygook > (like > > several superimposed images at the top of the screen) with the 08 and 09 > versions. > > > Anybody know what is wrong? > > What video card are you using ATI RAGE128 > and do you know which version of the VESA vbe it is using? Nope. How do I find out? Thanks. And a general thanks for the fractint work. Any suggestions for a video card that works particularly well with fractint for a Wintel box? Mike Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 08-05-01 (A Riot of Color [6]) Date: 08 May 2001 00:12:42 -0400 (EDT) Classic FOTD -- May 08, 2001 (Rating 6) Fractal visionaries and enthusiasts: Another very busy day has come and gone here at Fractal Central, a day that produced a most colorful fractal. Yes, today's FOTD image is one of my most colorful, though strangely enough, the colors give little impression of gaudiness. The image was created by the iterated formula 2Z^(-2.2)+2Z^(-1.1)+(1/C). After some thought, I named the image "A Riot of Color". I decided on the name after studying the image and finding myself unable to ignore the unusually brilliant colors. I rated it a 6, mainly because of the colors. I am now using patch 9 of the float-only version of Fractint, which as far as I can tell is free of major bugs. However I have seen reports of video problems with this version, which luckily do not show up on my dedicated fractal machine shackled as it is by a humble video card with a mere 1 meg of memory. I use the float-only version because its smaller footprint permits me to shell to DOS even with all the TSR's loaded, and for some reason, it also runs marginally faster. (DOS is an old abandoned operating system, which nobody in their right mind would still be using.) :-) Luckily, I'm not in my right mind. ;-) Since today's parameter file is a rather slow one, a download of the GIF image is strongly recommended. That file will soon be posted to Paul Lee's web site at the URL: and to Scott Boyd's site at: The fractal weather today was brilliant, with deep blue cloudless skies, a gentle east wind and a temperature of 65F (18C). The cats approved of these conditions by sleeping all afternoon on their porch chairs. And now it's almost midnight -- time to shut down the fractal shoppe and settle into my ponder chair to fall asleep watching a junky sci-fi film. I'll pull a video tape off the shelf at random . . . I just picked "Deadly Ray from Mars"! That should be junky enough. Until tomorrow and another fractal, take care, and there's a 50 percent chance that the world is at least as real as a fractal. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ A_Riot_of_Color { ; time=0:20:14.20--SF5 on a p200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=-5.96142116875996600/+0.100053880965341\ 40/1.539293e+009/1/7.499/-0.001 params=2/-2.2/2/-1.1/0/300 float=y maxiter=2500 inside=0 logmap=403 periodicity=10 colors=000XRUVQRUQNSOJRNHOMDNK8MJ6KI2JH0IH0JO2JV8J\ bEKiKKqQKwXIzcKzaNy_OsZRnYUiXVcVY_SZVRaQQcKOeFNgAM\ i6Kk8OmBRnEUoHXqJZrMasOcuRfwUjyXmzZozarzcuzfwzizzk\ zz0fw3sf2zZ3zR4zR6zR7zS8ySAvSAuSBrUDqUEoUFmUHkUHjQ\ EiMDgJBfFAeD7e86c64b23a00c02a23Z44X86UB6RE7OI8MKAJ\ NBHS8DQBFNEIMHKJJNHMQFOSDRVAUY8X_6Zb3ae2cg0fj0fk0g\ k0gk2ek3ck4ak7ak8Zk6ZiAYkDXnFVoJUrMSsORvSQwVOzYNzZ\ OwZQuZRrZRnZSkZUiZUeZVbZX_ZXXZYUZZRbYNZZOXZOU_OR_O\ OaQMaQJbQHbQEcQIeNKeKNeJQeHUeEXeDZeAae8Ke24f08f0Dg\ 0Hg0Ki0Oi0Sj0Xj0_k0ck0gm0km0on0sq0ws0zv0zy0zz0zz0z\ z0zz0zz0zz0zz0zz0zz0zz0z30z00z00z00s00o00k00i00f40\ c70aA0ZE0XH0UK0RN0OQ0MS0KV0JY0I_0Hb0Fe0Eg0Bj0Am08o\ 07r06u04w03y07v0As2Dq6FnBIkHKiKNfQQcUSaZVZcYXg_Umb\ RreOvgMzjJzjMzjOzjRzjUzjVzjYzj_zjbzjezjfzmYzoQzoJz\ qDzq6zr0zr0zs0zs0zu0zu3zv7zwAzyEzzHzzKzzQzzNzzKzzI\ zzFzzDzzAzz7zz4zz3zz2zz0z } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "James R. McKenzie" Subject: Re: (fractint) Fractint patch 20.1.09 Date: 07 May 2001 11:50:27 -0400 I got the same thing with 20.1.08. All I got was about an inch of the image at the top of the screen (17 inch Mag Innovison 770DX running fractint @ 1024x1280) believe it or not my Vid cards and old ATI All In Wonder Pro hard-wired @ 8 meg of RAM. Fractint 20.1.15 runs just fine like this but anything newer won't. Oh well, for what ever it's worth that's my spare change thrown in. T H A N K Y O U James R. McKenzie jimmckenzie@earthlink.net ----- Original Message ----- Sent: Monday, May 07, 2001 12:10 AM > I have a problem with the latest Fractint patch and with 20.1.08. The SF4-SF-9 > video modes work with 20.1.07 and earlier models but yield gobbledygook (like > several superimposed images at the top of the screen) with the 08 and 09 versions. > > Anybody know what is wrong? > > Mike > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 07-05-01 (Spiralesque [4]) Date: 07 May 2001 10:24:02 EDT Classic FOTD -- May 07, 2001 (Rating 4) Fractal visionaries and enthusiasts: Being forced into too much yard work, (Picking up one stick is too much.) I found little time for fractal fun. But in the end the yard work was worth it. The yard now looks better, and the fractal, which I eventually did get to, rates a 4, which is not too bad. The formula behind the image is -1.5(Z^1.2)+1.5(Z^1.3)+C, a modest expression that would be expected to do little, and indeed does but little. But that little that the formula does manage to do holds at least a few interesting things. Today's unusual spiral is one of those things. The spiral is unusual in that its 8 arms are unusually fragmented, and not at all the smoothly blended things that would be expected. While studying and trying to color the image, I felt the impression of something vaguely sinister, and considered a corresponding name, but being unable to pin down the cause of my impression, I settled on the neutral name, "Spiralesque". The parameter file renders in just over 9 minutes. The GIF file will be available for download in an hour or so at: and at: The fractal weather today, with its partly cloudy skies and temperature of 65F (18C), was perfect for yard work. It was also perfect for fractal cats, but the intrepid duo was annoyed by the activity, and spent most of the day indoors. I eased their frustration with a treat of tuna. It's now the middle of the morning and time for other work. Until next FOTD, which will appear in 12 hours or so, take care, and don't overwork. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Spiralesque { ; time=0:09:10.69--SF5 on a P200 reset=2001 type=formula formulafile=critical.frm formulaname=MandelbrotMix4 function=ident passes=1 center-mag=+1.936911287737238/+7.881112847818978/7\ .861229e+008/1/-147.5 params=-1.5/1.2/1.5/1.3/0/800 float=y maxiter=900 inside=0 logmap=174 periodicity=10 colors=000P00mmPmmHmmJmkLmiLmgNkeNedP`bPV`RNZTHXTC\ VV6TV0RX0PX00K0AK0GN6ACH42T00d00iA0mNHq``ukoxtzzzz\ xwzuuzqqzkixgbsdVk`NeeRkiVomXss`vvbzzezzizzkzzozzq\ zzuzzvzzxzzzzzzzuzzmzzezzZzzPzzHzzAzz2zz0zz0zz0zz0\ zz0zz2zz8zzGzzNxzVuz`oxgkvoguvdqz`ozXkzTizPgzLkzHm\ uGqkCsbAsV6pL2mC0m20m00m00m00m00m04m0Ao0Hq0Ns4VoAb\ kEgeJobNuZTzVXzPbzLezHizEgzLezTdz`bzg`xoZsvXmzVgzV\ bzX`zXZzXXzXVzXVzXTzXRzZPzZNzZNzZLzZJzZHzZGzZGzgCz\ qAzz6zz4zz0zs0zk0vd0uX0qR0oJ0kC0i40e00d00b00V20N80\ GE8AJH2PP0VZ0`e0Pb0G`H6ZZC``G`bJbdNbeRbgVdiZdkbdmg\ eokeqogssguvgvzixzizzizzeuzdqx`muZiqVeoTbkPZgNVeJR\ bHNZEJXCGVALV8PT8VT6ZR4dR4gR2mP0qP0vN0zN0zL0zL0zL0\ zP0zT6zXCz`HzdNxeTsiZomdkqikuouvszkvz`xzPzzLvzHuzG\ szCqz8oz6mz2kz0kz0kz0kz0kz0kz6kzEkzLkzTmz`ozgqzosz\ suzuvzvxzxzuzzmzzezzZzzRzzJzzCzz4zz0zz0zz0zz0zz0zz\ 4zzCuzJqzRmzXgzddzkZzsVzz } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul N. Lee" Subject: Re: (fractint) Fractint patch 20.1.09 Date: 08 May 2001 02:17:21 -0500 Mike Traynor wrote: > > Jonathan wrote: > > > > What video card are you using > > ATI RAGE128 > > Any suggestions for a video card that > works particularly well with fractint > for a Wintel box? > I have no problems with my DIAMOND Viper V770D Ultra NVIDIA 32-MB. Also had nothing on my older machines which use these: Video-67P/Video-67TV Linear Accelerated for PCI TRIDENT 2-MB PCI DIAMOND Stealth 64-PCI Sincerely, P.N.L. http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Sylvie Gallet Subject: Re: (fractint) No hard feelings Date: 08 May 2001 06:12:06 -0400 Zorba, I'm starting to find your insistence quite irritating! As Mike explain= ed to you, these images rely on Fractint artifacts and they loose their texture when rendered in UF and anti-aliased. These images, with their particular texture, ARE MINE, and nobody has a right to say they should look like this or like that. I've never seen any Fractint or Ultra Fract= al from you on the discussion lists, but if you were sharing some, you would= probably understand my feeling. - Sylvie Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) IFS and L-system anomations... Date: 08 May 2001 12:03:44 -0500 "Tony (Anthony) Hanmer" wrote: > Thanks for the advice so far. The L-system info is particularly > interesting. But I'll now rephrase what I'm looking for: > A way of copying and incrementing the digits of a small sample of TEXT, > to a set degree, a set number of times. Forget the L-system or IFS... If you're a programmer, this is rather trivial. If not, less so. Perl could do the job in minutes. Visual BASIC or C could do the job with not much more work than that. If you've ever used BASIC, you might be able to whip something up in Word Macros. Or how about doing something with Excel? It can handle series of various types. If you saved the worksheet in the right manner,..... If you have access to unix or linux, shell scripts would work great. -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) RE: C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 08 May 2001 12:05:18 -0500 Thomas Bennett wrote: > I see no reason why an interest in fractals > automatically condemns me to an interest in how the > rest of the world works. "Condemns". Interesting way of putting it. > Now I am posting off topic. It's usually considered that the topic of what's on/off topic is always on topic (at least in most news groups and e-lists I've known). -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) What is on topic or off topic Date: 08 May 2001 12:07:18 -0500 Tim Wegner wrote: > Here's an example of a related topic that I think is fine for this list. > > Here's an animated zoom made from NASA imagery that reminds me a lot of > animated zooms I have made with fractint. Very, very cool mpegs!!! Thanks for the URL. So,.... if something *reminds* me of something in FractInt, it's on topic then?... ;-\ Kewl! -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 08 May 2001 12:09:30 -0500 John Lewis wrote: >> You have to go a long, long way to get **OUT** **INTO** the galactic >> environment before you can begin to look for dark matter. > > The question then is if we got out of the solar system, how would we > know if we had bumped into some dark matter? Would we in fact notice, > or would it be too diffuse? Our ability to detect very small bits of stuff is actually quite good. So, assuming it's made of normal matter and we can get close enough, yes, I believe we'd detect it. Which reminds me of something in FractInt.... ;-| -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Guy Marson Subject: Re: (fractint) Fractint patch 20.1.09 Date: 08 May 2001 21:45:16 +0200 Hi Jonathan, I got the same problems with the same card: ATI RAGE 128 MAGNUM SD only video=f3 is working fine.. all ok 'till Ver. 20.1.08.. cheers, Guy Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Ricardo M. Forno" Subject: RE: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 08 May 2001 21:14:25 -0300 I don't believe so. Dark matter could be very massive at the galactic level, but probably it is so thin as a nearly perfect vacuum. ----- Original Message ----- Sent: Tuesday, May 08, 2001 2:09 PM > John Lewis wrote: > > >> You have to go a long, long way to get **OUT** **INTO** the galactic > >> environment before you can begin to look for dark matter. > > > > The question then is if we got out of the solar system, how would we > > know if we had bumped into some dark matter? Would we in fact notice, > > or would it be too diffuse? > > Our ability to detect very small bits of stuff is actually quite good. > So, assuming it's made of normal matter and we can get close enough, > yes, I believe we'd detect it. > > Which reminds me of something in FractInt.... ;-| > > -- > |_ CJSonnack _____________| How's my programming? | > |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | > |_____________________________________________|_______________________| > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jonathan Osuch" Subject: Re: (fractint) Fractint patch 20.1.09 Date: 08 May 2001 20:57:01 -0500 Guy, > ATI RAGE 128 MAGNUM SD > only video=f3 is working fine.. all ok 'till Ver. 20.1.08.. The changes in patch 8 shouldn't have had any affect on the 256 color modes. I'll check into it tomorrow. Jonathan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jonathan Osuch" Subject: Re: (fractint) Fractint patch 20.1.09 Date: 08 May 2001 20:53:58 -0500 Mike, >> and do you know which version of the VESA vbe it is using? > Nope. How do I find out? I use a program written by Shawn Hargreaves called vesainfo.exe. But, it doesn't appear to be readily available on the web. I've also used svgainfo.exe, which I ran across in the last couple of months as I was trying to learn how to program the truecolor modes. It's in the DOS 16 bit Demonstrations section at: http://www.rbthomas.freeserve.co.uk/Downloads.html > Any suggestions for a video card that works particularly well with fractint > for a Wintel box? My experience with older (and I stress older) ATI cards is that they need a VESA TSR in order to support the VESA modes. I have not had any lengthy experience with them since the mach 8, but I've always had trouble with them. Tim Wegner tested a bunch of cards a year or so ago, and he is currently using one with an Nvidia TNT chipset. I have a machine with a 3dfx chipset, but I think they went belly up. There was/is an entry on the Fractint bug list about a video card problem, but I think that got worked out. Jonathan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: DeBow Freed Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 08 May 2001 22:26:43 -0500 Fellow Fractaliers & Speculators Upon Dark Matter (as long as we're all throwing in our 2cents' worth):

All this stuff about the alleged makeup of the Universe compels me to point out that until 1987, nobody had a clue as to the identity, or structure, or spectra of the principal component of common soot (i.e., the black stuff that forms when anything is burned in air, or, is exposed to extreme heat [>2Mdegrees in a interstellar-quality vacuum[<<1 x 10^-12torr]).

After it was discovered at Rice University that year (the Nobel Prize went to 3 chemists - 1 from Rice, 2 from Cambridge who were using Rice's spectrometers, vacuum chambers and lasers), and then recognized as a sphere to be almost totally inert, and incredibly common in space, people sbegan to realize and then speculated that "fullerene" - an inert soccer ball of pure Carbon - could account for almost 100% of then- unaccounted-for ("dark") matter out there.

Subsequent spectroscopy throughout the electromagnetic continuum  has confirmed its abundance and uniformity - lending to support to the theory.

On topic?? I think so because spherical C60 is just one member of a family of spherical carbon molecules, fragments, and aggregates which follow a beautiful multi-fractal size distribution curve. Another form (cylindrical and/or toric) is an almost perfect insulator, another a high temp superconductor with rare magnetic properties, etc. Fractal behavior and characteristics literally everywhere you look, if you choose to see it.

I find it interesting that this "fractal" compound (like Jim's "fractal" cats) was there the whole time(it was initially thought to be an artifact in an RF spectrum of an extremely hi-temp, lo-pressure flame - also like Wilson's cosmic microwave background radiation which lay undiscovered until 1962-ish when it, too, was thought to be an artifact in a [multifractal] microwave spectrum.

This compound in all its forms is BLACK as can be in Infrared, Visible, and UV light, ubiquitous, & fractal to the hilt:  from the way it tiles(i.e, forms) a sphere and a cylinder; to the way it fragments and re-aggregates, and in most of aspects of all its EM and other spectra - even in its absence of spectrum (or dropout, absorbence, etc).

"Buckminsterfuller-ene" (a totally inert, symmetric 60-carbon molecule which tiles a fractal family of spheres, planes, tubes, chains & helices with hexagons and pentagons) is a great example of an entity fractal in almost everything it does. And could very well account for 99% of the as-yet-uncharacterized ("dark") matter in the universe. Black soot.

DBF

"Ricardo M. Forno" wrote:

I don't believe so. Dark matter could be very massive at the galactic level,
but probably it is so thin as a nearly perfect vacuum.
----- Original Message -----
From: Programmer Dude <cjsonnack@mmm.com>
To: <fractint@lists.xmission.com>
Sent: Tuesday, May 08, 2001 2:09 PM
Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4])

> John Lewis wrote:
>
> >> You have to go a long, long way to get **OUT** **INTO** the galactic
> >> environment before you can begin to look for dark matter.
> >
> > The question then is if we got out of the solar system, how would we
> > know if we had bumped into some dark matter? Would we in fact notice,
> > or would it be too diffuse?
>
> Our ability to detect very small bits of stuff is actually quite good.
> So, assuming it's made of normal matter and we can get close enough,
> yes, I believe we'd detect it.
>
> Which reminds me of something in FractInt....   ;-|
>
> --
> |_ CJSonnack <Chris@Sonnack.com> _____________| How's my programming? |
> |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL  |
> |_____________________________________________|_______________________|
>
> --------------------------------------------------------------
> Thanks for using Fractint, The Fractals and Fractint Discussion List
> Post Message:   fractint@lists.xmission.com
> Get Commands:   majordomo@lists.xmission.com "help"
> Administrator:  twegner@fractint.org
> Unsubscribe:    majordomo@lists.xmission.com "unsubscribe fractint"

--------------------------------------------------------------
Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   fractint@lists.xmission.com
Get Commands:   majordomo@lists.xmission.com "help"
Administrator:  twegner@fractint.org
Unsubscribe:    majordomo@lists.xmission.com "unsubscribe fractint"

Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "David Jones" Subject: Re: (fractint) Fractint patch 20.1.09 Date: 08 May 2001 18:49:26 -1000 On 8 May 01 at 20:53, Jonathan Osuch wrote: > I have a machine with a 3dfx chipset, but I > think they went belly up. Nope, just bought out by nVidia. has the details. David gnome@hawaii.rr.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 09 May 2001 08:35:28 EDT DeBow Freed wrote: >"Buckminsterfuller-ene" (a totally inert, symmetric 60-carbon molecule >which tiles a fractal family of spheres, planes, tubes, >chains & helices with hexagons and pentagons) is a great example of >an entity fractal in almost everything it does. And could very well account >for 99% of the as-yet-uncharacterized ("dark") matter in the universe. >Black soot. I have two thoughts, (a very rare event), about such dark matter: First, would not so much soot totally block the light of the distant stars, in much the same manner as dust blocks the view of the center of our galaxy? Second, where there is dark matter, there also must be dark energy. What do we know of this dark energy? Could it be the same energy that is causing the expansion of the universe to accelerate? FOTD for May 9 in 2 hours; FOTD for May 10 in 15 hours. Jim M. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 09-05-01 (Fractal Brushes [7]) Date: 09 May 2001 10:36:18 EDT Classic FOTD -- May 09, 2001 (Rating 7) Fractal visionaries and enthusiasts: I had rather good luck finding today's fractal. Unfortunately, I had no such luck in finding the time to write about the fractal, so this brief note will have to suffice. While the P1, P2 and P3 values that are entered into the formula are 1.3,-13,13,-1.3,-2, and 800, the actual iterated expression is 1.3(Z^(-13))-13(Z^(-1.3))+(1/C). The image rates an honest 7. The eight brush-like elements surrounding the ubiquitous central midget are unlike anything I have yet come upon in my fractal adventures. These brushes are not artifacts of clever fractal manipulation on my part. They are real features drawn by the classic equal-iteration-band coloring method. I named the image "Fractal Brushes" because that's what I saw. The parameter file renders in 12-1/2 minutes, which is slow enough to make a download of the image the preferable method of viewing the scene. The download will be available in an hour or so at Paul's web site at: and at Scott's site at: The fractal weather today was ideal. The sky was blue, the temperature reached 69F (20.5C), but the cats complained when I had no chance to give them the time outdoors that they wanted. Well, as I see the jobs, which I really should be working on, piling up around me, I guess it's time to say, 'until next time, take care, and be peaceful. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Fractal_Brushes { ; time=0:12:22.16--SF5 on a p200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+1.240913461043476/+0.8117822172036/1.4\ 53451e+009/1/-32.499 params=1.3/-13/13/-1.3/-2/800 float=y maxiter=1350 inside=0 logmap=227 periodicity=10 colors=000FgQFiQFkQFkQ8eO26M0VJ08H0JF0FD0BB0FF0HJ0\ JO0MQ0OV0QZ0S`0Ve0Wi2Zn6bp8etBgxFizHkzMnzOpzQrzVtz\ WvzZxzSzzOzzJzzDzz8zz4zz0zz0zz0zx0zv0xz0tz4nzBizHb\ zMZzSVzZOzeJzkDzr8zv4zr6zn8zkBzgDzeFv`FpZHkVJeS0ZO\ OVHHKHQJFYDBV88W24W02Z00`00b00e00e00W04Q0DJ0JD0S60\ Z04g0Bn0Hv0Mz0Sz0Wr4t`gzVbzQZzJVzDOz8Jz2Fz0Bz06z00\ z00z00z00z00z00z00z00z00z00z02z06x08t0Bp2Fk6Hg8MeD\ O`HSWJVSOWOS`JVbHZgDbi8en4ip0kr0tt2zt6zvBzvFzvJzrM\ znOziQzgQzbSvZVpWWkSWeOZ`M`VHbQDbJBeF6g82i40iB2nH4\ pO6rS6tZ8xeBzkBzpDzvFzzFzzHzzJzzJzzMzzOzzOzzJzzHzz\ DvzBnz6bz4Vz0Jz0Bz00z00z00z00z00z00z00z00z00z20z40\ z60z60zB0zD0zF2xH2tJ4rM6nO6iQ8eVB`WBZZDV`FQbFMeHHg\ JFiJ0rz0tz0tz4vz8vzDxzJxzOzzSzzZzzbzzgzz`zzWzzSzzO\ zvHzpDzk8ze4z`0zW2ze4zk4zr6zz6zz8zz8zzBzzBzzFzzJzz\ OzzSzzWzz`zzezvizrnzkrzgtz`xzWzzQzzMzzFzzBzz4zz0zz\ 0zz0zz0zz0zz0zzVzzSzzSzzS } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: DeBow Freed Subject: (fractint) Response to Jim Muth's comments re fractal fullerenes as dark matter- Date: 09 May 2001 10:53:01 -0500 Jim-

Two good thoughts is more than I have in a year.

WRT Comment #1 - Most published calculations of the density of dark matter, under almost any reasonable assumptions about the total mass of fullerenes in the Universe,  & the % which is in the most stable state (the spherical C60 molecule), suggest that each molecule in interstellar space would be many light yrs apart - hardly enough "haze" to physically block out even a measurable amount of visible light;

If you work it the other way, assuming sparsely-distributed spherical C60 exists, accounts for all or almost all of the dark matter, and reduces the observed intensities of "light" and other parts of the EM spectrum, it would uniformly reduce background luminosity <1%. More importantly, people see the drop outs (absorption spectra) they expect to see for both the spherical (inert) and other varieties of fullerenes.

Finally, a sphere of C60 is actually shiny black (in the visible, for example), so it also - if thought of as a microscopic "planet" with an albedo - would reflect almost all incident EM radiation omnidirectionally. It indeed reflects at all but a few frequencies, where its absorbence spectrum has been characterized and observed: it's actually the perfect "stealth" molecule, if you think about it.

WRT Thought #2: All I know is that mass of course implies energy, but apparently the assumptions there (age of the Universe, how rapidly it is expanding, not expanding or pulsating, # of Black holes, etc) totally determine the answer - the "energy budget".

Apparently you can wave your arms around and calculate just about any result for energy. In contrast, at least by starting with mass and structure of spherical C60 ("fullerene"), we know: it exists, it's inert, it's sperical, and what its spectrum is throughout the EM continuum - so you can link your assumptions to observable, objective fact. (And then start waving your arms and making assumptions which probably also completely determine the answer.)

Thanks for the comments.

Much of the basic work on fullerene chemistry, structure and EM spectra, and its subsequent application by others to astrophysics and materials science, can be found by starting with "Robert Curl PhD, Chemistry, Rice University",
one of the 3 Nobel prize-winners for Chemistry (in ~1995) based on their 1986-7 work - one of the fastest Nobel awards ever made.

You might check the links on his web page at www.riceuniv.edu or something similar.

Freed
 
 

JimMuth@aol.com wrote:

DeBow Freed wrote:

           <snip>
>"Buckminsterfuller-ene" (a totally inert, symmetric 60-carbon molecule
>which tiles a fractal family of spheres, planes, tubes,
>chains & helices with hexagons and pentagons) is a great example of
>an entity fractal in almost everything it does. And could very well account
>for 99% of the as-yet-uncharacterized ("dark") matter in the universe.
>Black soot.

I have two thoughts, (a very rare event), about such dark matter:  First,
would not so much soot totally block the light of the distant stars, in much
the same manner as dust blocks the view of the center of our galaxy?
Second, where there is dark matter, there also must be dark energy.
What do we know of this dark energy?  Could it be the same energy that
is causing the expansion of the universe to accelerate?

FOTD for May 9 in 2 hours; FOTD for May 10 in 15 hours.

Jim M.

--------------------------------------------------------------
Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   fractint@lists.xmission.com
Get Commands:   majordomo@lists.xmission.com "help"
Administrator:  twegner@fractint.org
Unsubscribe:    majordomo@lists.xmission.com "unsubscribe fractint"

Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Tony (Anthony) Hanmer" Subject: (fractint) Chameleons Date: 09 May 2001 22:35:18 +0500 This is a multi-part message in MIME format. ------=_NextPart_000_2983_14b0_7b33 Content-Type: text/plain; format=flowed What are chameleons made of? If they're fractal, more chameleons. This one is coloured the way it is because: a) I didn't change the colours from the original, and b) chameleons can be any colour they please. (Hope the par works as it is below.) Par-frm file begins Chameleons { ; zoom of Jim Muth's FOTD "Semi-Chaos" by Tony Hanmer 2001 reset=2001 type=formula formulafile=fractint.frm formulaname=mandelbrotbc passes=1 center-mag=-0.50341539942036780/-0.59866488476619710/19405.59/-1.2019/44\ .998 params=1.618034/0/122/0 float=y maxiter=40000 inside=0 logmap=145 periodicity=10 sound=off colors=00050U4DU2DU0FU0FU00U05U0AU0Fc5KmCPpKVnR_kYdidiekndss`zy_zzWzzVzz\ SzzPzzNzzM<2>zpHzlFzgCwdAu`9qY7pS5lP4kM2gH0eD0bA0`70Y20W00S00P00R00<17>S\ 00S00S00<2>S00S00S20S20S20S22S42S42V44<3>V55V55V57V77V77V79V79V99<2>V9AW\ 44V57V79V9AV9CSADSCFSDHSDISFKRHNRHPRIRRKSRMVPMWPNYPP_PR`PRbNSe<3>NdlMgnM\ ipMkqMls_qseuu`quYnuWguN`wP`wP_wP_wR_wRYyRYySYySWySWyVWzVVzVVzWVzWSzWSzY\ SzYRzYRz_Rz_Pz_Pz`Pz`Pz`NzbNzbNzbMzdMzdMzdKzeKzeKzeIzgIzgIzgHziHziHziFzk\ FzkFzkDzlDzlDzlCznCznCznAzpAzpAzs7zq9zqAzsCzsDzsFzsHzuIyuKuuMqwNpwPlwRiy\ SeyVbyW`<2>z`Rz_Kz`MzbNzbPzdRzeSzeVzgVziWziYzk_zk`zlbzndzndzpezqgzqizskz\ slzunzwnzwpzyqzzszzuzzwzzw<2>zzlzzkzzizzg<27>zzg } MandelbrotBC = { ; Z = Z^E + C e=p1 p=real(p2)+PI q=2*PI*trunc(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z|<4 } _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. ------=_NextPart_000_2983_14b0_7b33 Content-Type: message/rfc822 From owner-fractint@lists.xmission.com Wed May 09 08:41:40 2001 Received: from [198.60.22.7] by hotmail.com (3.2) with ESMTP id MHotMailBCC2B028001240043259C63C16079BC90; Wed May 09 08:41:32 2001 Received: from domo by lists.xmission.com with local (Exim 2.12 #2) id 14xW4X-00010D-00 for fractint-gooutt@lists.xmission.com; Wed, 9 May 2001 09:40:17 -0600 Message-ID: <3AF967DD.DE1E9A3@airmail.net> Organization: The BMC Group / USA X-Mailer: Mozilla 4.7 [en]C-NSCPCD (Win98; U) X-Accept-Language: en MIME-Version: 1.0 Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) References: <16.c8ac6b0.282a9390@aol.com> Content-Type: text/html; charset=us-ascii Content-Transfer-Encoding: 7bit Sender: owner-fractint@lists.xmission.com Precedence: bulk Reply-To: fractint@lists.xmission.com Jim-

Two good thoughts is more than I have in a year.

WRT Comment #1 - Most published calculations of the density of dark matter, under almost any reasonable assumptions about the total mass of fullerenes in the Universe,  & the % which is in the most stable state (the spherical C60 molecule), suggest that each molecule in interstellar space would be many light yrs apart - hardly enough "haze" to physically block out even a measurable amount of visible light;

If you work it the other way, assuming sparsely-distributed spherical C60 exists, accounts for all or almost all of the dark matter, and reduces the observed intensities of "light" and other parts of the EM spectrum, it would uniformly reduce background luminosity <1%. More importantly, people see the drop outs (absorption spectra) they expect to see for both the spherical (inert) and other varieties of fullerenes.

Finally, a sphere of C60 is actually shiny black (in the visible, for example), so it also - if thought of as a microscopic "planet" with an albedo - would reflect almost all incident EM radiation omnidirectionally. It indeed reflects at all but a few frequencies, where its absorbence spectrum has been characterized and observed: it's actually the perfect "stealth" molecule, if you think about it.

WRT Thought #2: All I know is that mass of course implies energy, but apparently the assumptions there (age of the Universe, how rapidly it is expanding, not expanding or pulsating, # of Black holes, etc) totally determine the answer - the "energy budget".

Apparently you can wave your arms around and calculate just about any result for energy. In contrast, at least by starting with mass and structure of spherical C60 ("fullerene"), we know: it exists, it's inert, it's sperical, and what its spectrum is throughout the EM continuum - so you can link your assumptions to observable, objective fact. (And then start waving your arms and making assumptions which probably also completely determine the answer.)

Thanks for the comments.

Much of the basic work on fullerene chemistry, structure and EM spectra, and its subsequent application by others to astrophysics and materials science, can be found by starting with "Robert Curl PhD, Chemistry, Rice University",
one of the 3 Nobel prize-winners for Chemistry (in ~1995) based on their 1986-7 work - one of the fastest Nobel awards ever made.

You might check the links on his web page at www.riceuniv.edu or something similar.

Freed
 
 

JimMuth@aol.com wrote:

DeBow Freed wrote:

           <snip>
>"Buckminsterfuller-ene" (a totally inert, symmetric 60-carbon molecule
>which tiles a fractal family of spheres, planes, tubes,
>chains & helices with hexagons and pentagons) is a great example of
>an entity fractal in almost everything it does. And could very well account
>for 99% of the as-yet-uncharacterized ("dark") matter in the universe.
>Black soot.

I have two thoughts, (a very rare event), about such dark matter:  First,
would not so much soot totally block the light of the distant stars, in much
the same manner as dust blocks the view of the center of our galaxy?
Second, where there is dark matter, there also must be dark energy.
What do we know of this dark energy?  Could it be the same energy that
is causing the expansion of the universe to accelerate?

FOTD for May 9 in 2 hours; FOTD for May 10 in 15 hours.

Jim M.

--------------------------------------------------------------
Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   fractint@lists.xmission.com
Get Commands:   majordomo@lists.xmission.com "help"
Administrator:  twegner@fractint.org
Unsubscribe:    majordomo@lists.xmission.com "unsubscribe fractint"

Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------=_NextPart_000_2983_14b0_7b33-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Bill Jemison Subject: (fractint) Response to Jim Muth's comments re fractal Date: 10 May 2001 10:42:44 -0400 Debow Freed - would it be possible for you to turn off the "html only" mo= de that your mail is using? asci only would be great. Thanks Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 10-05-01 (High Iteration [5]) Date: 10 May 2001 10:46:19 EDT Classic FOTD -- May 10, 2001 (Rating 5) Fractal visionaries and enthusiasts: Once again an unexpected rush job turned up, and the FOTD is correspondingly late. No apologies, but I'll make no further promises about the time the next day's FOTD's will appear. The Mandelbrot set has been called the most complex object in mathematics. This means than no supercomputer or super program will ever be able to reach more than an infinitesimal part of its entirety. But this fact does not keep dedicated fractalists from trying. Today's scene, which strives to infinity, lies in the second valley of a bud lying deep in the south edge of East Valley. It is a relatively inaccessible area, not because of its small size, but because of the high iterations needed to reveal its features. The maxiter of 200,000 is high, but well within the reach of modern desktop and laptop computers. The logmap value of 9,000 is somewhat exaggerated to produce the effect of a black background. The render time of 13 minutes, however, is faster than would be expected for such a deep high-iteration image. I gave the image the unassuming and totally technical name "High Iteration". Being unable to decide whether today's result of 25 minutes fractal effort is good or bad, I rated the image a 5, which is average. Viewers can decide for themselves whether my rating is too liberal or too conservative by running the parameter file, or by waiting an hour or so and downloading the GIF image from the Web at: and at: The fractal weather today started with light rain, turned partly cloudy by noon and cleared at sunset. The temperature of 74F (23C) brought out the cats, who enjoyed an afternoon in the yard, even while complaining about the wet grass. Until next time, take care, and if reason won't bring an answer, what will? Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ High-Iteration { ; time=0:13:04.94--SF5 on a p200 reset=2001 type=mandel passes=1 center-mag=+0.25465091424675380/-0.000586320365777\ 95/2.867577e+009/1/-147.5 params=0/0 float=y maxiter=200000 inside=0 logmap=9000 periodicity=10 colors=0000000hz0hz0hz0lz0lz2lz2lz2qz6qz6qzBqzBvzG\ vzGvzKvzKzzPzzPzzUzzUzzUzzZzzZzzczzczzhzzhzzlzzlzz\ qzzqzzvzzvzzvzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\ zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\ zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\ zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\ zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\ zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\ zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\ zvyvvxvqwqqvqlulhtlhshcrhcqcZpcUoZUnZPmUPlUKkPGjPG\ iKBhKBgG6fG2eB2dB0c60bB0a60`60_60Z60_60`60a60b22c2\ 2d22e22f22g22h22i02j02k06l06m06n06o06p06q06r06s06t\ 0Bu0Bv0Bw0Bx0By0Bz0Bz0Bz0Gz0Gz0Gz0Gz0Gz0Gz0Gz2Gz6G\ zBKzGKzKKzPKzUKzZKzcKzhKzlKzqPzvPzzPzzPzzPzzPzzPzz\ PzzUzzUzzUzzUzzUzzUzz0zz0zz0zz0zz0zz0zz0zz0zz0zz0z\ z0zz0zz0zz0zz0zz0zz0zz0zz } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) C-FOTD 10-05-01 (High Iteration [5]) Date: 10 May 2001 09:59:28 -0500 JimMuth@aol.com wrote: > Until next time, take care, and if reason won't bring an answer, > what will? Prayer? (Sorry, couldn't resist!) -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) C-FOTD 09-05-01 (Fractal Brushes [7]) Date: 10 May 2001 10:03:05 -0500 JimMuth@aol.com wrote: > The eight brush-like elements surrounding the ubiquitous central > midget are unlike anything I have yet come upon in my fractal > adventures. They are way cool! Thanks for--once again--bringing out the magic of the "simple" 256-color fractal! -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: (fractint) Dark Matter & Fractals Date: 10 May 2001 10:20:43 -0500 "Ricardo M. Forno" wrote: >> Our ability to detect very small bits of stuff is actually quite good. >> So, assuming it's made of normal matter and we can get close enough, >> yes, I believe we'd detect it. > > I don't believe so. Dark matter could be very massive at the galactic > level, but probably it is so thin as a nearly perfect vacuum. [shrug] Could be. But I have a friend who does some work with ultra- high vacuum systems (down to nano-tor range), and from what I gather, we're pretty good at identifying even lonely little atoms in all that emptiness. (And the way they gage high vacuum....very, very weird!) And trying desperately to drag this back on topic... like fractals, the universe has structure from huge, huge scales (groups of clusters of galaxies) down to very, very tiny scales (sub-atomic). But UNLIKE fractals, the structure is not self-similar. Or does that depend on how you define self-similar? There is a binary nature that pervades reality and which shows up at many levels. Is there self-similarity in this? Is reality fractal? Life--similar to fractals--can be "zoomed in" on with ever changing discovery of details. In a sense, every day is a new "zoom" into a new area that owes *something* to the previous "image", although Thursday isn't a tiny piece of Wednesday. But somehow, in my (addled?) mind, I'm seeing birth as that first image of the Mbrot that you see when you launch FractInt. And each of us chooses a course ("zooms" down and down on a point). And because the level of detail is infinite, each of us can find a slightly different point to zoom towards (read: slightly different person to become). Some of us--who have nearby "points"--are somewhat like each other (but never identical). Others of us are quite different (think of zooms from very different spots on the Mbrot). Some of us are pretty simple (think of a zoom from far away from the Mbrot boundary), while others of us are quite complex (and "interesting", but c.f. the old Chinese curse). So,.... if YOU were a Mbrot image, what/where would YOU be? -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: DeBow Freed Subject: Re: (fractint) Response to Jim Muth's comments re fractalfullerenes as Date: 10 May 2001 13:16:48 -0500 According to my ISP, no. Sorry. Reason for your request? Bill Jemison wrote: > Debow Freed - would it be possible for you to turn off the "html only" mode > that your mail is using? asci only would be great. Thanks > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: harry Subject: Re: (fractint) Dark Matter & Fractals Date: 10 May 2001 18:19:28 -0400 Programmer Dude wrote: > > > So,.... if YOU were a Mbrot image, what/where would YOU be? I'd be a Jim Muth FOTD image. I'd be lost somewhere on the internet between Jim's e-mail and a web site. You would all be pissed off because I wasn't where I should be, when I should be... ;^) H^) harry > > Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Bill Jemison Subject: (fractint) Response to Jim Muth's comments re Date: 10 May 2001 18:36:54 -0400 I believe it's a function of your email program, not your isp. The reason= for the request is that I use an ascii email and your messages have been coming through as blank with an attachment...html code. I have to d/l the= attachment separately and then use an html reader. However, since I got this one OK perhaps I am speaking to the wrong perso= n. If so, I'm sorry! Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul N. Lee" Subject: Re: (fractint) Response to Jim Muth's comments re fractalfullerenes as Date: 10 May 2001 18:53:28 -0500 Bill Jemison wrote: > > I believe it's a function of your email program..... > ....(snipped)..... > However, since I got this one OK perhaps I am > speaking to the wrong person. > Mr. DeBow Freed uses Netscape ver.4.7 (128-bit encryption). His copy is set within the PREFERENCES to automatically respond in the same manner as the email was posted. But on a new message, it will revert to HTML as the default. At least his settings are not set to send both a text and an HTML copy in the same email (this would be Content-Type of multipart/alternative). Sincerely, P.N.L. http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul Wyszkowski" Subject: Re: (fractint) Dark Matter & Fractals Date: 10 May 2001 21:41:18 -0400 ----- Original Message ----- Sent: Thursday, May 10, 2001 11:20 AM > And trying desperately to drag this back on topic... like fractals, > the universe has structure from huge, huge scales (groups of clusters > of galaxies) down to very, very tiny scales (sub-atomic). But UNLIKE > fractals, the structure is not self-similar. > > Or does that depend on how you define self-similar? > > There is a binary nature that pervades reality and which shows up at > many levels. Is there self-similarity in this? > > Is reality fractal? Life--similar to fractals--can be "zoomed in" on > with ever changing discovery of details. In a sense, every day is a > new "zoom" into a new area that owes *something* to the previous "image", > although Thursday isn't a tiny piece of Wednesday. > Good question what _does_ "self-similarity" mean? In the case of mathematical objects called fractals, self-similarity is imposed by the algorithm generating the fractal: the computation of points representing the fractal structure is restricted to a specific, finite and usually small set of operations which tends to produce similar results over and over again. Whatever the scale or "depth of zoom" the computation sequence remains the same so self-similarity persists at all scales. In the "real" world, the computation algorithm would be represented by the complete set of the "laws od nature", such as Theories of Everything attempt to define. If such a set of universal laws exists, and if it is finite and unchanging, then perhaps one might expect to see evidence of self-similarity in all phenomena at all scales though it would likely be much less obvious than it is in fractals. Paul Wyszkowski Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 11-05-01 (High Iteration-II [6]) Date: 10 May 2001 21:47:09 -0400 (EDT) Classic FOTD -- May 11, 2001 (Rating 6) Fractal visionaries and enthusiasts: As is well known to all fractal explorers, some parts of the Mandelbrot set are far easier to explore than other parts. In some cases the difficulty arises because the magnitude of the scene being explored is extremely great. In other cases it is an extremely large maxiter that causes the difficulty. At one time, today's scene would have been agonizingly slow because of its very high maxiter, but the modern computers have reduced the task of rendering the image from an overnight wait to a 6-1/2 minute lull. I named the picture "High Iteration-II", since it is the second high-iteration scene in the M-set, yesterday's FOTD being the first. The pictured midget is located deep on a lateral arm of a star at the end of the main filament of a tiny, high- periodicity bud sitting in the chaotic area on the northwest edge of the main bay of the Mandelbrot set. (Anyone care to diagram that sentence?) The image is exceptional for its multitude of curving and converging arms, as well as for the overall chaotic appearance. This image looks its best at the highest resolution possible, though the render time given in the parameter file is based on a 640x480x256 resolution. Once again I have exaggerated the logmap setting to give greater detail to the deeper parts of the image, which lie near the midget. Undecided whether to rate the image a 5 or a 6, I decided on a 6, since a comparison with yesterday's 5-rated image shows a slight improvement. As always, the image file soon will be available on the W.W.Web at the URL: and also at: The fractal weather today was sunny and warm. The temperature of 84F (29C) was just what the fractal cats ordered. And with the immediate rush behind me, I had a chance to give them all the outdoor time they wanted. It's still a relatively early 9:30pm here at the shuttered and locked fractal shoppe. With the day's work done and the FOTD completed, I'll probably relax watching one of my many junky old sci-fi films. And when tomorrow comes, I'll be here again with another fractal and more words. Until then, take care, and does water really go down the drain clockwise in the Southern Hemisphere? Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ High_Iteration-II { ; time=0:06:32.42--SF5 on a p200 reset=2001 type=mandel passes=1 center-mag=-0.41555266473912380/+0.574990591393049\ 40/3.034837e+008/1/-52.5 params=0/0 float=y maxiter=75000 inside=0 logmap=6655 periodicity=10 colors=000S0XS0VS0VS0TS0TQ0SQ0SQ0QQ0OQ0OO0NO0NO0LO\ 0LO0JN0JN0HN0GN0GL0EL0EL0CL0CL0BJ0BJ09J07J07J06H06\ H04H04H02J04H02H02H02H02G02G02G02G02G02E02E02E22E2\ 2C40C60C60C70C80B90BA0BB0BC09D09E09F09G09H07H07H07\ H07H06H06H06H06H06H04J04L04N04P04R02T02V02X02Z00a0\ 0a00c00c00d00f00f00h00h00i00k00k00m00m00n00p00p00r\ 00t00t00u00u00w05y0Ay0Fz0Kz0Pz0Uz0Zz0cz0hz0mz0mz0m\ z0mz0cz0Uz0Kz0Ay60tB0mH0hN0aT0XZ0Qd0Lh0Ek0Gk0Gj0Hi\ 0Gh0Fg0Gf0Fe0Ef2Ff2Ef2Df2Ef2Df2Df2Ef2Eh4Dg4Fg4Ff4F\ g4Hg4Ih4Jk4Kl6Lm6Ln6Oo6No6No6Oo6Op6Np6Pq7Pr7Qs7Qt7\ Qu7Su7Sw7Sw7Uw9Uw9Uw9Vw9Vw9Vy9Xy9Xy9XyBZyB_yB`yBay\ BczBezBizBkzCkzCmzCmzCmzCnzCnzCnzCpzCpzErzErzErzEt\ zEtzEtzEuzEuzGuzGwzGwzGwzGyzGyzGyzGzzHzzHzzHzzHzzH\ zzHzzHzzHzzJzzJzzJzzJzzJzzJzzJzzJzzGzzHzzJzzJzzLzz\ LzzNzzNzzOzzOzzQzzQzzSzzSzzTzzTzzVzzVzzXzzXzzZzzZz\ z_zz_zzazzczzczzczzczzczz } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) C-FOTD 10-05-01 (High Iteration [5]) Date: 10 May 2001 09:59:28 -0500 JimMuth@aol.com wrote: > Until next time, take care, and if reason won't bring an answer, > what will? Prayer? (Sorry, couldn't resist!) -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: jerome schatten Subject: (fractint) 8 bit colour Date: 11 May 2001 18:18:17 -0700 Linux wizards: Is there any clever way of going from 16 bit colour (my normal setup) to 8 bit colour when bringing up xfractint other than reconfiguring x each time? A command line solution or a short script perhaps? Regards, jerome Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Scott D. Boyd" Subject: Re: (fractint) 8 bit colour Date: 11 May 2001 20:58:24 -0500 Jerome, On Friday 11 May 2001 20:18, you wrote: > > Is there any clever way of going from 16 bit colour > (my normal setup) to 8 bit colour when bringing up > xfractint other than reconfiguring x each time? A > command line solution or a short script perhaps? > Unfortunately - no. You have 2 options - restart your Xserver with "startx -- -bpp 8", or use Xfractint 20.1.06 or newer. Starting with version 20.1.06, you can run Xfractint while in true-color mode, but color-cycling no longer works. Of course, Xfractint still only generates 256-color gif files. The latest versions are available at www.fractint.org Have fun, Scott Boyd -- sdboyd56@swbell.net http://sdboyd.dyndns.org/~sdboyd/ I always wanted to be a procrastinator, but I never got around to it. -- Unknown Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 12-05-01 (Fritzles in Sight [5]) Date: 12 May 2001 00:06:57 -0400 (EDT) Classic FOTD -- May 12, 2001 (Rating 5) Fractal visionaries and enthusiasts: As I write these words, an invisible, blue, green and red fritzle is standing three feet behind my chair. No, I cannot give proof that it *is* there, but neither can anyone prove that it is not there. The elusive critter lies just beyond the range of human vision, in fact, when the planets are aligned in just the right way, the fritzle briefly becomes visible. It became visible earlier this evening. It was visible for only 37 seconds, but that brief appearance gave me just enough time to grab my fractal camera, load some fractal sensitive film, and take a photo of the fritzle. That photo appears as today's FOTD. I have no idea where the supernumerary fritzles came from. They were not there when I took the photo. I also have no idea why the MandelbrotBC1 draws a picture of the fritzle. I suppose it's a case of fortuitous synchronicity, but whatever it is, the image is there, and it has been declared FOTD for May 12th. The formula behind the fritzle is Z^1.5+C, calculated far, far down the logarithmic spiral. The fritzle is filled with hard-to- find midgets, which I did not zoom in on, since the fritzle itself, even without a midget, is good enough. And I can always bring up one of the midgets tomorrow if the mood strikes. I named the image "Fritzles in Sight" more as a caption than a title. I rated it a 5 because I miss a midget at the center. The fritzle renders in just under 3 minutes. It will appear in even less time for those who download the GIF image from: or from: after giving Paul and Scott a chance to render and post the image. The weather today was a bit warm, but the humidity was low, making for a pleasant May afternoon. The fractal cats enjoyed the 88F (31C) temperature by spending the afternoon in the grass. I'm now going to spend the rest of the evening doing nothing but watching the water go down the drain. Being water, it has no knowledge of the direction of the earth's rotation, and goes down turning in whatever direction it chooses. Until tomorrow, take care, and don't get dizzy watching the water. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Fritzles_in_Sight { ; time=0:02:55.92--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotBC1 function=floor passes=b center-mag=+0.73591549295774630/-0.183648225469727\ 60/5333.333 params=1.5/0/-81219/0 float=y maxiter=2000 inside=255 logmap=49 periodicity=10 colors=000w_`w_`vZ_uYZtXYsWXrVWqUVrTUsRTtORvLQwIPx\ FNyCMzALq9Ih8F`7CS69J56B54C68D7BD7FE8NE8QF9SF9UGAW\ GAZHBaHBeIChIClIDoNDrPIrQOmRTkSYiTagUecVi`WlXXoUXq\ RVpNSoKQmHNlDLjAJi7If6Ic6Ha5HZ5HW4GU4GR3GO3FL2FJ2F\ I2GL3HR4IY5If5Jm6Kr7Ku7Js8Jo8Jl8Ih8Ie8Ib9I`9HY9HW9\ HT9HRAGOAGMAGJAGHAJJBMLBONBRPCURCWTCZVD`WDcYDf_Eha\ EkcEneFpgFsiFujFriEohElgDifDfeCcdC`cBYbBVaBS`AP_AM\ Z9JY9GX8DW8AV8AT6BS5BR4BQ3AT79VB8XF7_J6aN5cR4eV3hZ\ 2jb1lf0nj0lh0jf0he0gc0eb0c`0b_0`Y0_X0ZW0YV0WT0US0S\ Q0RP0PN0NL0MK0KI0IH0HF0FE0DC0BA0A9087066054033011h\ 9eg8df8ce8bd8bc8ac8`b7_a7_`7Z_7Y_7XZ7XY6WX6VW6UW6U\ V6TU6ST5RS5RS5QR5PQ5OP5OO4NO4MN4LM4LL4KK4JK4IJ3II3\ HH3GG3FG3FF3EE2DD2CC2CC2BB2AA299198188177166165154\ 04403303202101000MXVLWULWULVTKVTKUSKUSJTRJTRJSRISQ\ IRQIRPIRPHQOHQOHPOGPNGONGOMFNMFNLFMLEMLEMKELKELJDK\ JDKIDJICJICIHCIHBHGBHGBGF } frm:MandelbrotBC1 { ; by several Fractint users e=p1, a=imag(p2)+100 p=real(p2)+PI q=2*PI*fn1(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z| Subject: (fractint) C-FOTD 12-05-01 (Fritzles in Sight [5]) Date: 12 May 2001 19:55:19 +1200 At 16:06 12/05/2001, Jim Muth wrote: >Classic FOTD -- May 12, 2001 (Rating 5) > >Fractal visionaries and enthusiasts: > >As I write these words, an invisible, blue, green and red >fritzle is standing three feet behind my chair. What, invisible _and_ blue, green and red?! Fractint can't support PNG soon enough - then we can render fritzles more accurately with the alpha channel! Morgan L. Owens "*bonk* - oh, 'scuse me." Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: Re: (fractint) C-FOTD 12-05-01 (Fritzles in Sight [5]) Date: 12 May 2001 11:27:35 EDT Morgan Owens wrote: >What, invisible _and_ blue, green and red [fritzles]?! Yes! Amazing isn't it. Actually, when the planets are in the proper alignment, fritzles become visible and reveal their usually hidden colors. Don't blame me for the inconsistency. And btw, I've already found one of those midgets that lie hidden in all fritzles. Do I really believe in fritzles? That's for me to know and others to guess. Jim M. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Bill Jemison Subject: (fractint) Response to Jim Muth's comments re Date: 12 May 2001 15:24:18 -0400 I would prefer both over no text, but if he doesn't care to be read by *all* he will get his way . Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jim Shaffer, Jr." Subject: Re: (fractint) 8 bit colour Date: 12 May 2001 17:31:39 -0400 > Unfortunately - no. You have 2 options - restart your Xserver with > "startx -- -bpp 8", or use Xfractint 20.1.06 or newer. Assuming you're using Linux, can't you just start a second Xserver on a different virtual console, and leave your main one running? -- Earth for Earthlings! Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 13-05-01 (Fritzleland Midget [5]) Date: 12 May 2001 21:23:17 -0400 (EDT) Classic FOTD -- May 13, 2001 (Rating 5) Fractal visionaries and enthusiasts: To find today's scene I went exploring down into the 'Fritzle' image of yesterday. I went in search of midgets. The midgets proved elusive, but I finally tracked one down and rendered it for the whole world to see. The search was difficult because in the Z^1.5 Mandeloid, the midgets have no symmetrical pattern surrounding them. They can be found however by searching for the areas where several discontinuities converge, and zooming in on the center of convergence. An additional difficulty in searching for midgets in the Mandeloids of an order between 1 and 2 is that the midgets lie far deeper than in the classic Z^2 M-set. I often find the midgets, and know that they're down there, but then run out of resolution before reaching them. The midget in today's scene luckily lies at a relatively shallow depth in the bottomless parent fractal. After studying the image a minute or two, I named it "Fritzleland Midget". I chose the name because the image illustrates a scene in Fritzleland. I rated it a 5. The image lost 1 point because its central midget is virtually shapeless. Do I believe in fritzles? Of course! I invented them. I believe in them just as I believe in a talking rabbit named Bugs Bunny. Bugs is far more real to most people of the world than I am, so how can anyone say that I exist and Bugs Bunny doesn't? The same is true of fritzles. Before wandering too far from the topic, I'd best tell that the parameter file renders in 11 minutes, more or less. And unless the internet is bogged down, the GIF file of the image downloads in 10 percent of that time. The GIF image may be found in an hour or so posted to Paul's web site at: and also at Scott's site at: The fractal weather today was pretty good. There were more clouds than yesterday, and a brief shower spoiled the afternoon, but the temperature of 83F (28C) was judged ideal by the cats. As for me, it's Saturday evening, and that means a junky sci-fi or horror movie. Since the local TV station is still showing "Doctor Who", one of my favorite 'do a lot with a little' series, I'll probably watch that. And within 24 hours, I will have found another fractal, which will be the next FOTD. Until that glorious time arrives, take care, and there is indeed one thing that can pass back and forth through the event horizon of a black hole. That thing is thought. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Fritzleland_Midget { ; time=0:11:10.09--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=mandelbrotbc1 function=floor passes=b center-mag=+0.73593566678892110/-0.183549714634885\ 30/9.894864e+008 params=1.5/0/-81219/0 float=y maxiter=7200 inside=255 logmap=382 periodicity=10 colors=000H0gJ0eL0dL0`N0ZN0XP0VR0TR0RT0PT0LT0NX0N`\ 0Pb0Pe0Ri0Rm0To4Ts8VvCVzGXzJXzNZzRZzV`zZ`zbbzebzib\ zkdzkdzkdzmdzmdzmdzodzodzodzzdyzdxvdvtdtqdrndpkdnh\ dledjb`h_XfXVdURbRN`OLZLHVGGRACN68J06G02C00E00G04H\ 08H0CJ0GL0JN0LN0PP0TR0XT2`T4dV4gX6iZ6mZ8q`AubAxdCz\ oEzdCzVCvJCoACg0C`0CT0CL0GP0HR0LT0NV0PX0TZ0V`0Zd0`\ e0bg0ei0gk2im4mo6os8suAuvCvxEzzGzzHzzGzzEzzCzzAxz8\ vz6vz4uz4sz2qz0oz0oz0mz0kz0iz0gz0ez0ez0dz0bz0`z0Zz\ 0`z0Zz0Zz0Xz0Xz0Vz0Vz0Tx0Tx0gx4cv6cz8_zCUzERsGQsJL\ qLJqLHvNJqPJmPJiRLeTLbTLZVNVVNUXNZZPcZPh`Pm`RrbRwd\ Ywdhze`weRmeTcbTUZTKVTARVGNVNJVVEVbAVi6Xo2Xv0Xz0Xz\ 0Tz0Xz0`z0bz0ez0gz0kz2mz4qz6uz8vzAzxCzvEzuGzsHzqAz\ kJzqXzvimzv`zzPzzTzzXzuZzqbzmezggzdkzZozVqzRuzLxzH\ zzCzz8zz4zz0zz0zz0zz0zz0zz0zz0zz0zz0zz0zz0zz0zz0zz\ 2zz6zz8zzAzzCzzEzzGzzGzzHzzHzzJzzJzzLzzLzzNzzNzzPz\ zPzzRzzRzzTzzTzzGzzGzz000 } frm:MandelbrotBC1 { ; by several Fractint users e=p1, a=imag(p2)+100 p=real(p2)+PI q=2*PI*fn1(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z| Subject: Re: (fractint) 8 bit colour Date: 13 May 2001 00:05:28 -0700 "Scott D. Boyd" wrote: > > Jerome, > > On Friday 11 May 2001 20:18, you wrote: > > > > Is there any clever way of going from 16 bit colour > > (my normal setup) to 8 bit colour when bringing up > > xfractint other than reconfiguring x each time? A > > command line solution or a short script perhaps? > > > Unfortunately - no. You have 2 options - restart your Xserver with > "startx -- -bpp 8", or use Xfractint 20.1.06 or newer. Starting with > version 20.1.06, you can run Xfractint while in true-color mode, but > color-cycling no longer works. Of course, Xfractint still only generates > 256-color gif files. The latest versions are available at www.fractint.org > OK... 'startx -- -bpp 8' is far better than running Xconfigurator each time... it works for me. Thanks Scott! There's a huge time delay in trying to stop colour cycling in the linux version... it's a real crap-shoot... I wonder why? Other strange anomalies as well, but it does work. Regards, jerome Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jonathan Osuch" Subject: (fractint) Fractint version 20.1.10 Date: 13 May 2001 07:21:04 -0500 The latest developer's version, 20.1.10, is now available on the developer's web site. This patch fixes a problem with ATI video cards. www.fractint.org The Xfractint sources still haven't been updated (since 20.1.07). Maybe this next week. Thanks to Guy Marson, I was able to identify the problem patch 20.1.08 was causing with ATI video cards. > techno-babble on < I had put in a sanity check that looked at whether two bits were set. One is used to indicate if the selected video mode is compatible with the VGA hardware registers and I/O ports. This would indicate that we could use the standard frame buffer addresses. The other is used to indicate if the selected mode provides windowing or banking of the frame buffer. This is necessary because we are unable to use the linear frame buffer at this point in time. > techno-babble off < If you had a problem with your ATI video card prior to version 20.1.08, I have no idea what caused it. The last patch prior to 20.1.08 that affected the graphics routines was 19.61 patch 48. Jonathan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mike Traynor Subject: Re: (fractint) Fractint version 20.1.10 Date: 13 May 2001 15:17:13 -0400 Jonathan, > > The latest developer's version, 20.1.10, is now available on the developer's > web site. This patch fixes a problem with ATI video cards. > > www.fractint.org > > The Xfractint sources still haven't been updated (since 20.1.07). Maybe > this next week. > > Thanks to Guy Marson, I was able to identify the problem patch 20.1.08 was > causing with ATI video cards. Thanks! Works fine now. Mike Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: John Lewis Subject: (fractint) Windows Me Date: 13 May 2001 12:31:33 +0100 Can you use Fractint for DOS on a Windows Me computer were DOS= seems to be well hidden, please? John -- John Lewis, jlewis@clara.net on 05/13/2001 Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: davides Subject: Re: (fractint) Windows Me Date: 13 May 2001 16:45:50 -0400 At 12:31 PM 5/13/2001 +0100, you wrote: > >Can you use Fractint for DOS on a Windows Me computer were DOS seems >to be well hidden, please? > >John > > >-- John Lewis, jlewis@clara.net on 05/13/2001 While I am not the person to ask, especially as I haven't run Fractint for a long time due to lack of time, I do have other DOS based programs which run fine under WinME; that being the case, I should think Fractint would run ok. If nothing else, on my version, I can always access DOS via: (Start/Programs/Accessories/MSDOS Prompt) HTH. Peace, Peace, David S. A computer without Windows is like a fish without a bicycle. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "George Priest" Subject: (fractint) float only version Date: 13 May 2001 14:07:24 -0700 This is a multi-part message in MIME format. ------=_NextPart_000_003F_01C0DBB6.08F0BF20 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable Can someone tell me briefly the difference between the regular Fractint = and the float only version. Could I install the float-only version in = the same directory with the regular version and rename it something like = FractinF? George Priest geopriest@raincity.com ------=_NextPart_000_003F_01C0DBB6.08F0BF20 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
Can someone tell me briefly the = difference between=20 the regular Fractint and the float only version.  Could I install = the=20 float-only version in the same directory with the regular version and = rename it=20 something like FractinF?
 
George Priest
geopriest@raincity.com<= /DIV>
 
------=_NextPart_000_003F_01C0DBB6.08F0BF20-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jonathan Osuch" Subject: Re: (fractint) float only version Date: 13 May 2001 17:09:00 -0500 George, > Can someone tell me briefly the difference between the regular Fractint and the float only > version. Could I install the float-only version in the same directory with the regular version > and rename it something like FractinF? The float only version has all the integer fractal types removed as well as the integer math routines. Yes, you could install the float-only version (renamed) in the directory as the regular version. There is a problem with how the help file is located, however. If the help is separated from fractint.exe, there should be no problem. But, I think this has to be done before the two are linked together. I don't have any experience with this, but Tim Wegner has done it in the past to allow the executable to reside on drive a: and the help file to reside on drive b:. He may have more insight into what needs to be done. Jonathan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jonathan Osuch" Subject: Re: (fractint) Fractint version 20.1.10 Date: 13 May 2001 17:10:05 -0500 > The Xfractint sources still haven't been updated (since 20.1.07). Maybe > this next week. Done. Jonathan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: jerome schatten Subject: Re: (fractint) 8 bit colour Date: 13 May 2001 15:21:33 -0700 "Jim Shaffer, Jr." wrote: > > > Unfortunately - no. You have 2 options - restart your Xserver with > > "startx -- -bpp 8", or use Xfractint 20.1.06 or newer. > > Assuming you're using Linux, can't you just start a second Xserver on a > different virtual console, and leave your main one running? > > -- > Earth for Earthlings! > Here's what happens when I try that: Fatal server error: Severver is already active for display 0. If this server is no longer running, remove /temp/.X0-lock and start again. Regards, jerome Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 14-05-01 (A Sizzling Sizzler [8]) Date: 14 May 2001 09:04:35 EDT Classic FOTD -- May 14, 2001 (Rating 8) Fractal visionaries and enthusiasts: Today's fractal is one of my better ones -- at least in my opinion. With little time to describe the image, I will say only that the scene lies deep in a many-pointed star on a filament extending from a small bud on the shore of the curious fractal that results when a certain amount of 1/Z has twice as much Z subtracted from it. The image is better than average, but does it sizzle? Each viewer will have to answer that question for him/her self. I named the image "A Sizzling Sizzler" because while trying to think of a better name, I caught the aroma from a neighborhood cookout. I imagined the meat sizzling on the grill and I had my name. The rating of 8 might be a bit optimistic, but I need a few images that rate more than a ho-hum 6. The parameter file renders in 16 minutes, making a download of the GIF image the far more convenient way of viewing the scene. The download may be found at Paul's web site at: and at Scott's site at: The URL of Scott's site is new. I assume it works, though I have not yet had the time to check. The fractal weather today was near perfect, with sunny skies and a temperature of 72F (22C). The cats approved vigorously. That's it for this time fractal fans. I'll return with the next FOTD within 24 hours for sure, and likely within 14 hours. Until then, take care, and ain't fractals fun? Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ A_Sizzling_Sizzler { ; time=0:15:52.80--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=-0.1617817738589964/+0.5084149801137444\ /787885.6/1/145 params=1/-1/-2/1/-0.502/10 float=y maxiter=2400 inside=0 logmap=178 periodicity=10 colors=000zz6wzCtvIqvOnvTtvTzo7zo7zm7zm7zm7zi9xf9s\ a9p_9lXAiSAdPAaLAYIAVFCQACO7CJ3CG0DC0D90D40D10D00G\ 00I00J00L00O00P00Q00S00T01X03Y04_06`07c09d0Af0Cg0D\ i0Fl0Gm0Io0Jp0Ls0Mu0Ov0Px0Qy0Sv0Tu0Vs1Xp3Yo4_m6`j7\ ai9cgAddCfcDgaFi_GjYIlXJmTLoSOoQPpPQrMSsLTuJVvGXxF\ YyD_zA`z9az7cz4dz3fz1gz0iz0jz0lz0mz0mz0mz0oz0oz0oz\ 0pz0py0px0rv0ru1rs1sr3sp3so3um4ul4uj6vi6vg6vf7xd7x\ c9xa9y`9y_AyYAzXCzVCzTCzSDzQDzPFzOFzMFzLGzJGzIIzGI\ zFIzDJzCJzALz9Lz7Lz9Jz9Jz9Jz9Iy9Ix9Iv9Gu9Gs9Gr9Gp9\ Fo9Fm9FlADjADiADgACfACdACcACaAA`AA_AAYA9XA9VA9TC7S\ C7QC7PC7OC6MC6LC6JB4HA4E94C83973763673AB6DF9FHCILF\ JOILQJOSMPVPQXSS_VT`XVc_Xda_gd`igaljcmldpofrrguujv\ xlyymzzozzpzzrzzszzrzzpzzpzzozzmzzmzzlzzjzzjzzizyg\ zxgzvfzudzudzsczrazpazo`zm_zm_zlYzjXziXzgVyfTydTyd\ SycQxaQx`Px_OxYOxYOz_Oz`Oz`QzYSzVTzTVzQYzP_zM`zLaz\ IdzFfzDgzAiz9lz6mz4oz1pz0 } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 14-05-01 (A Sizzling Sizzler [8]) Date: 14 May 2001 09:04:35 EDT Classic FOTD -- May 14, 2001 (Rating 8) Fractal visionaries and enthusiasts: Today's fractal is one of my better ones -- at least in my opinion. With little time to describe the image, I will say only that the scene lies deep in a many-pointed star on a filament extending from a small bud on the shore of the curious fractal that results when a certain amount of 1/Z has twice as much Z subtracted from it. The image is better than average, but does it sizzle? Each viewer will have to answer that question for him/her self. I named the image "A Sizzling Sizzler" because while trying to think of a better name, I caught the aroma from a neighborhood cookout. I imagined the meat sizzling on the grill and I had my name. The rating of 8 might be a bit optimistic, but I need a few images that rate more than a ho-hum 6. The parameter file renders in 16 minutes, making a download of the GIF image the far more convenient way of viewing the scene. The download may be found at Paul's web site at: and at Scott's site at: The URL of Scott's site is new. I assume it works, though I have not yet had the time to check. The fractal weather today was near perfect, with sunny skies and a temperature of 72F (22C). The cats approved vigorously. That's it for this time fractal fans. I'll return with the next FOTD within 24 hours for sure, and likely within 14 hours. Until then, take care, and ain't fractals fun? Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ A_Sizzling_Sizzler { ; time=0:15:52.80--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=-0.1617817738589964/+0.5084149801137444\ /787885.6/1/145 params=1/-1/-2/1/-0.502/10 float=y maxiter=2400 inside=0 logmap=178 periodicity=10 colors=000zz6wzCtvIqvOnvTtvTzo7zo7zm7zm7zm7zi9xf9s\ a9p_9lXAiSAdPAaLAYIAVFCQACO7CJ3CG0DC0D90D40D10D00G\ 00I00J00L00O00P00Q00S00T01X03Y04_06`07c09d0Af0Cg0D\ i0Fl0Gm0Io0Jp0Ls0Mu0Ov0Px0Qy0Sv0Tu0Vs1Xp3Yo4_m6`j7\ ai9cgAddCfcDgaFi_GjYIlXJmTLoSOoQPpPQrMSsLTuJVvGXxF\ YyD_zA`z9az7cz4dz3fz1gz0iz0jz0lz0mz0mz0mz0oz0oz0oz\ 0pz0py0px0rv0ru1rs1sr3sp3so3um4ul4uj6vi6vg6vf7xd7x\ c9xa9y`9y_AyYAzXCzVCzTCzSDzQDzPFzOFzMFzLGzJGzIIzGI\ zFIzDJzCJzALz9Lz7Lz9Jz9Jz9Jz9Iy9Ix9Iv9Gu9Gs9Gr9Gp9\ Fo9Fm9FlADjADiADgACfACdACcACaAA`AA_AAYA9XA9VA9TC7S\ C7QC7PC7OC6MC6LC6JB4HA4E94C83973763673AB6DF9FHCILF\ JOILQJOSMPVPQXSS_VT`XVc_Xda_gd`igaljcmldpofrrguujv\ xlyymzzozzpzzrzzszzrzzpzzpzzozzmzzmzzlzzjzzjzzizyg\ zxgzvfzudzudzsczrazpazo`zm_zm_zlYzjXziXzgVyfTydTyd\ SycQxaQx`Px_OxYOxYOz_Oz`Oz`QzYSzVTzTVzQYzP_zM`zLaz\ IdzFfzDgzAiz9lz6mz4oz1pz0 } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jim Shaffer, Jr." Subject: Re: (fractint) 8 bit colour Date: 14 May 2001 17:39:10 -0400 > Here's what happens when I try that: > > Fatal server error: > Severver is already active for display 0. > If this server is no longer running, remove /temp/.X0-lock > and start again. You should be able to start an X server on a different virtual console: X -bpp 8 :1 & You can then start xfractint on it with "xfractint -display :1" and switch between the control display and the graphic display with ctrl-alt-f7 and ctrl-alt-f8 (or whatever VC it puts it on). In theory, you should *also* be able to get the control display on the new X server with "xterm -display :1", but when I try it on my Mandrake 7.2 system, it locks up the system. I have no idea why. In fact, in theory you should be able to get a complete GUI on the second X server simultaneously with "startx -depth 8 -- :1" or something similar, but when I try that it locks up too. I have no time to delve into the configuration of KDE and whatnot to see what's going wrong. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Scott D. Boyd" Subject: Re: (fractint) 8 bit colour Date: 14 May 2001 20:55:48 -0500 On Monday 14 May 2001 16:39, Jim Shaffer, Jr. wrote: > > You should be able to start an X server on a different virtual console: > > X -bpp 8 :1 & > > You can then start xfractint on it with "xfractint -display :1" and > switch between the control display and the graphic display with > ctrl-alt-f7 and ctrl-alt-f8 (or whatever VC it puts it on). > mmmm.... that sounds interesting. I'll have to try that sometime soon. I too had tried quite a while ago to start up an X server on the second virtual console, but I remember I got some error message. Of course - I used the startx command, so it didn't work. > In theory, you should *also* be able to get the control display on the > new X server with "xterm -display :1", but when I try it on my Mandrake > 7.2 system, it locks up the system. I have no idea why. In fact, in > theory you should be able to get a complete GUI on the second X server > simultaneously with "startx -depth 8 -- :1" or something similar, but > when I try that it locks up too. I'm just making a semi-intelligent guess here, but could it cause the system to run out of memory, considering that the primary X server/GUI uses up almost all of the RAM? (I also use Mandrake 7.2.) Scott Boyd -- sdboyd56@swbell.net http://sdboyd.dyndns.org/~sdboyd/ I always wanted to be a procrastinator, but I never got around to it. -- Unknown Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Scott D. Boyd" Subject: Re: (fractint) 8 bit colour Date: 14 May 2001 21:00:18 -0500 On Monday 14 May 2001 16:39, Jim Shaffer, Jr. wrote: > > You should be able to start an X server on a different virtual console: > > X -bpp 8 :1 & > Well.... I just tried it and received the same error message that was reported earlier: Fatal server error: Server is already active for display 0 If this server is no longer running, remove /tmp/.X0-lock and start again. Scott Boyd -- sdboyd56@swbell.net http://sdboyd.dyndns.org/~sdboyd/ I always wanted to be a procrastinator, but I never got around to it. -- Unknown Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Scott D. Boyd" Subject: Re: (fractint) C-FOTD 14-05-01 (A Sizzling Sizzler [8]) Date: 14 May 2001 21:05:07 -0500 On Monday 14 May 2001 08:04, JimMuth@aol.com wrote: > and at Scott's site at: > > > > The URL of Scott's site is new. I assume it works, though I > have not yet had the time to check. > Yes Jim - it works. I had just been leaving a referring / auto-forwarding link on my swbell.net website. All my content is now being served from a Linux box running the Apache Web server here at mi casa. Keep those amazing FOTDs a-coming! Scott -- sdboyd56@swbell.net http://sdboyd.dyndns.org/~sdboyd/ I always wanted to be a procrastinator, but I never got around to it. -- Unknown Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Guy Hammer Subject: Re: (fractint) 8 bit colour Date: 14 May 2001 20:01:03 -0700 On Mon, 14 May 2001, Jim Shaffer, Jr. writes: > You should be able to start an X server on a different virtual console: >=20 > X -bpp 8 :1 & >=20 > You can then start xfractint on it with "xfractint -display :1" and swi= tch > between the control display and the graphic display with ctrl-alt-f7 an= d > ctrl-alt-f8 (or whatever VC it puts it on). OK - this works fine on my Caldera system. (ctrl-alt-f9 to get to X here) Now I find I've lost the e-mail about how to start xfractint in something other than the default 640x480 resolution mode. (a postcard in the upper left corner of my 19" 1600x1280 display... :) Any help appreciated in advance... -- Guy Hammer, guyh@aracnet.com http://www.aracnet.com/~guyh -- 8:00pm up 62 days, 20:55, 5 users, load average: 1.00, 1.00, 0.91 Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: jerome schatten Subject: Re: (fractint) 8 bit colour Date: 14 May 2001 20:54:03 -0700 "Jim Shaffer, Jr." wrote: > > > Here's what happens when I try that: > > > > Fatal server error: > > Severver is already active for display 0. > > If this server is no longer running, remove /temp/.X0-lock > > and start again. > > You should be able to start an X server on a different virtual console: > > X -bpp 8 :1 & > > You can then start xfractint on it with "xfractint -display :1" and switch > between the control display and the graphic display with ctrl-alt-f7 and > ctrl-alt-f8 (or whatever VC it puts it on). OK... finallly, I can bring up another X server with the above command. When I say bring up another X server, I get the dotted raster with the mouse position indicated by a heavy black 'X'. The mouse moves, but that's all that happens. It goes no further, so I can't issue the command 'xfractint -display :1'. I can, however, switch back and forth between my original X server and what I described above with ctl-alt-F7/ctl-alt-F8. Some progress anyway. jerome > > In theory, you should *also* be able to get the control display on the new X > server with "xterm -display :1", but when I try it on my Mandrake 7.2 system, it > locks up the system. I have no idea why. In fact, in theory you should be able > to get a complete GUI on the second X server simultaneously with "startx -depth > 8 -- :1" or something similar, but when I try that it locks up too. I have no > time to delve into the configuration of KDE and whatnot to see what's going > wrong. > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@fractint.org > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Scott D. Boyd" Subject: Re: (fractint) 8 bit colour Date: 14 May 2001 22:57:24 -0500 On Monday 14 May 2001 22:01, Guy Hammer wrote: > > OK - this works fine on my Caldera system. (ctrl-alt-f9 to get to X > here) Now I find I've lost the e-mail about how to start xfractint in > something other than the default 640x480 resolution mode. (a postcard > in the upper left corner of my 19" 1600x1280 display... :) Any help > appreciated in advance... xfractint -geometry 1600x1280 Have fun! Scott -- sdboyd56@swbell.net http://sdboyd.dyndns.org/~sdboyd/ I always wanted to be a procrastinator, but I never got around to it. -- Unknown Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 14-05-01 (A Sizzling Sizzler [8]) Date: 14 May 2001 09:04:35 EDT Classic FOTD -- May 14, 2001 (Rating 8) Fractal visionaries and enthusiasts: Today's fractal is one of my better ones -- at least in my opinion. With little time to describe the image, I will say only that the scene lies deep in a many-pointed star on a filament extending from a small bud on the shore of the curious fractal that results when a certain amount of 1/Z has twice as much Z subtracted from it. The image is better than average, but does it sizzle? Each viewer will have to answer that question for him/her self. I named the image "A Sizzling Sizzler" because while trying to think of a better name, I caught the aroma from a neighborhood cookout. I imagined the meat sizzling on the grill and I had my name. The rating of 8 might be a bit optimistic, but I need a few images that rate more than a ho-hum 6. The parameter file renders in 16 minutes, making a download of the GIF image the far more convenient way of viewing the scene. The download may be found at Paul's web site at: and at Scott's site at: The URL of Scott's site is new. I assume it works, though I have not yet had the time to check. The fractal weather today was near perfect, with sunny skies and a temperature of 72F (22C). The cats approved vigorously. That's it for this time fractal fans. I'll return with the next FOTD within 24 hours for sure, and likely within 14 hours. Until then, take care, and ain't fractals fun? Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ A_Sizzling_Sizzler { ; time=0:15:52.80--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=-0.1617817738589964/+0.5084149801137444\ /787885.6/1/145 params=1/-1/-2/1/-0.502/10 float=y maxiter=2400 inside=0 logmap=178 periodicity=10 colors=000zz6wzCtvIqvOnvTtvTzo7zo7zm7zm7zm7zi9xf9s\ a9p_9lXAiSAdPAaLAYIAVFCQACO7CJ3CG0DC0D90D40D10D00G\ 00I00J00L00O00P00Q00S00T01X03Y04_06`07c09d0Af0Cg0D\ i0Fl0Gm0Io0Jp0Ls0Mu0Ov0Px0Qy0Sv0Tu0Vs1Xp3Yo4_m6`j7\ ai9cgAddCfcDgaFi_GjYIlXJmTLoSOoQPpPQrMSsLTuJVvGXxF\ YyD_zA`z9az7cz4dz3fz1gz0iz0jz0lz0mz0mz0mz0oz0oz0oz\ 0pz0py0px0rv0ru1rs1sr3sp3so3um4ul4uj6vi6vg6vf7xd7x\ c9xa9y`9y_AyYAzXCzVCzTCzSDzQDzPFzOFzMFzLGzJGzIIzGI\ zFIzDJzCJzALz9Lz7Lz9Jz9Jz9Jz9Iy9Ix9Iv9Gu9Gs9Gr9Gp9\ Fo9Fm9FlADjADiADgACfACdACcACaAA`AA_AAYA9XA9VA9TC7S\ C7QC7PC7OC6MC6LC6JB4HA4E94C83973763673AB6DF9FHCILF\ JOILQJOSMPVPQXSS_VT`XVc_Xda_gd`igaljcmldpofrrguujv\ xlyymzzozzpzzrzzszzrzzpzzpzzozzmzzmzzlzzjzzjzzizyg\ zxgzvfzudzudzsczrazpazo`zm_zm_zlYzjXziXzgVyfTydTyd\ SycQxaQx`Px_OxYOxYOz_Oz`Oz`QzYSzVTzTVzQYzP_zM`zLaz\ IdzFfzDgzAiz9lz6mz4oz1pz0 } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul N. Lee" Subject: Re: (fractint) 8 bit colour Date: 15 May 2001 00:22:21 -0500 Jim Shaffer, Jr. wrote: > > You should be able to start an X server > on a different virtual console: > Who knows, before long maybe XFractInt will be running on a Palm Pilot as a terminal. ;-} http://www.idg.net/go.cgi?id=475078 P.N.L. http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 08:06:44 -0400 ------=_NextPart_001_0001_01C0DD15.FC159B20 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable An alternative explanation for the galactic rotation thing that is quite = interesting is buried several links under: http://www.reciprocality.com It involves influences of a time travel sort. No dark matter required. Quantized gravity or space/time are discussed in a number of places on th= e net.

Get Your Private, Free E-mail from MSN Hotmail = at http://www.hotmail.com.

------=_NextPart_001_0001_01C0DD15.FC159B20 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
An alternative= explanation for the galactic rotation thing that is quite interesting is= buried several links under:
 
&nb= sp;
It involves influences of a time travel sort. No dark matt= er required.
 
Quantized gravity or space/time= are discussed in a number of places on the net.
=


Get Your Private, Free E-mail from MSN Hotmail at= http://www.hotmail.com.

------=_NextPart_001_0001_01C0DD15.FC159B20-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 15-05-01 (All Pooped Out [7]) Date: 15 May 2001 08:54:09 EDT Classic FOTD -- May 15, 2001 (Rating 7) Fractal visionaries and enthusiasts: Where are all those extra FOTD's coming from? Every time I post through AOL, it seems to happen. Today's FOTD holds a surprise. During the first half of the render, it looks notably unimpressive, but the lower half features a most unusual Mandeloid. This is not a midget -- it is the whole fractal, which explains why the render goes so fast. The iterated formula is a simple one, subtracting a portion of Z^(-0.7) from Z^(0.7) then adding 1/C. The result is a picture of a totally pooped-out Mandeloid lying flat on its face. I had no choice but to name the image "All Pooped Out". I rated it a 7 because I think it's kind of cute, though I really don't care much for funny-face fractals. The render time of under 3 minutes is reasonable. If it is not reasonable enough, the GIF file of the image is available on the Web at Paul's site at: and at Scott's site at: The fractal weather today was reasonably pleasant, though a dry squall spoiled the evening. The afternoon temperature of 73F (23C) kept the cats happy. I've got a busy day coming, so that's it for now. Until next FOTD, take care, and see you soon. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ All_Pooped_Out { ; time=0:02:42.14--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=-0.0101616/-0.136298/22.56982/1/142.5 params=1/0.7/-1/-0.7/-4.5/5000 float=y maxiter=440 inside=bof60 logmap=yes periodicity=10 colors=0000xz0vz0sz0oz0lz0gz0dy0av0`s0Yp0Vm0Tj0Qg0\ Pd0Ma0L_0IX0FV0DV0AT09S06S06S04Q04Q03P03P01P01O00O\ 00O00M00M10M30L40L40L60J70J70J90IA0I70MA0IC0FD0CG3\ 7I64JA1LD0OI0PL0QO0SQ0VQ0XQ0YQ0_Q0`Q0aQ3dP4fP7gPAi\ PDjPGlPJmPLpOOrOQsOTuOXvO_xOazMczMfzMizMlzMozMrzMs\ zPrzSpzVoxYmu`lrajpcimdgjgfgjfdmdapc`saYv`Vy_SzYPz\ XMzVMzTLzVLzVJzVJzVIxVIuXGrXGpXFoXFnXFmXDmYDmYCm_C\ m_Am`An`9n`9oa7oa7pc6qc6qc4rd4sd3sf3tf1ug1ug0vg0vi\ 0vi0vi0vg0uf0tf0rc0p`0mY0kV0hS0eP0cM0`J0YG0VD0TA0R\ 70P40O00N11M36L4AK7FJ9JIAOICSGFXGG`FIdDLiDMmCOrCPv\ ASzATz9Vz7Vz9Xz9XzAYxAYuCYpC_lD_iD_dF`aF`YF`TGaQGa\ MIaJIcFJcAJc7Jd3Jd1Jf0Jd0Jc0Ja0J`0I_0IY0GX0FV0CT0A\ T07T09T09T09T09T07T06T37R47T39T67T97TA7TD7TF7TI7TJ\ 7TM7TO7TQ7VS7XV9YX9__9``9ac9cd9dg9fi9gj9il9jm9lo9m\ pDosImsOjsSguVfuZ`ubVufPvjJvoDvs7vv1yx0vz0uy0sx0rv\ 1pu3os4mr6lp7jo9imAglCfjD } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Fractint version 20.1.08 Date: 15 May 2001 08:56:14 -0400 ------=_NextPart_001_0002_01C0DD1C.E5C6AEC0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Memory. Because of the memory model we are using (medium), we can't fit= the >PNG libraries into Fractint. There are solutions. We have tried compil= ing >the Xfractint code using djgpp, but it needs work. Any volunteers? We = have >the experimental code which incorporates the Allegro graphics package bu= t no >way as yet to save images. We could add the PNG libraries to Xfractint = and >stop developing the DOS version. >We will eventually have to dump the current DOS source code, but would l= ike >to at least have something place for Windows before we do this. DJGPP + Allegro? Right on! That will give you 1 codebase that ports painlessly to DOS, Windoze, and = Linux-x86 console. An X86-enabled port of Allegro would not surprise me b= y appearing either.

Get Your Private, Free E-mail from= MSN Hotmail at http://www.hotmail.com= .

------=_NextPart_001_0002_01C0DD1C.E5C6AEC0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Memory.&nb= sp; Because of the memory model we are using (medium), we can't fit the>PNG libraries into Fractint.  There are solutions.  We ha= ve tried compiling
>the Xfractint code using djgpp, but it needs wo= rk.  Any volunteers?  We have
>the experimental code whic= h incorporates the Allegro graphics package but no
>way as yet to s= ave images.  We could add the PNG libraries to Xfractint and
>= stop developing the DOS version.

>We will eventually have to du= mp the current DOS source code, but would like
>to at least have so= mething place for Windows before we do this.
DJGPP + Alleg= ro? Right on!
That will give you 1 codebase that ports painles= sly to DOS, Windoze, and Linux-x86 console. An X86-enabled port of Allegr= o would not surprise me by appearing either.

=

Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0002_01C0DD1C.E5C6AEC0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 01-05-01 (Decorative Minibrot [6]) Date: 15 May 2001 09:00:43 -0400 ------=_NextPart_001_0003_01C0DD1D.865B62E0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >It is the square root of 3, a number I entered hoping >to create midgets with 3-way symmetry. As of yet, I have found >no such midgets, though I did find today's midget, which bears a >curiously close resemblance to a standard quadratic midget. >Only the chopped-off main bud reveals the midget's true nature. This is because the exponent is close to 2, but isn't exactly.

Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0003_01C0DD1D.865B62E0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>It is the = square root of 3, a number I entered hoping
>to create midgets with= 3-way symmetry.  As of yet, I have found
>no such midgets, th= ough I did find today's midget, which bears a
>curiously close rese= mblance to a standard quadratic midget.
>Only the chopped-off main = bud reveals the midget's true nature.
 
This i= s because the exponent is close to 2, but isn't exactly.



Get Your Private, Free E-mail from MSN Ho= tmail at http://www.hotmail.com.

------=_NextPart_001_0003_01C0DD1D.865B62E0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 09:30:25 -0400 ------=_NextPart_001_0004_01C0DD21.AD0948E0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Just a note: we can't detect it only because it does not emit light that >we can see. If we can't detect it why do we know it's there? We *can* detect it, inasmuch as we can infer its presence. But detecting = lots of things is done fairly indirectly. Extrasolar planets, for one. >Dark matter *could* just be ordinary, cold matter, and we >would never be able to see it...from earth. If we can ever get out into >the galaxy and universe, THEN we'd probably have no problem detecting it= . If we even recognized it. We might even trip over it. Check out the Rober= t Sawyer novel Starplex. You can tell it's one of his early novels becaus= e of the creeping featurism, but it's still damn good. >So we *know* Newton is a 'special case' version of the full laws of >motion. More an approximation for low velocities and low masses/tides. >On the other hand, a great deal of modern physics is based on the fact >(or more properly, assumption) that the laws of the universe are true >throughout the universe. This assumption has been explored in a variety >of ways, and largely seems to be taken as fact. >But who knows what really lies across the dark void, eh? There is evidence that the fine structure "constant", at the very least, = isn't; it varies over time or space very slightly. Major differences in t= he laws, however, can be ruled out to ~12Gly. A qualitative change in phy= sical laws would create an opaque or *very* odd transition zone and proba= bly can't exist. Serious quantitative variations in the nuclear force and= electromagnetic force coupling values would manifest in the character of= distant stars; there'd be *very* weird looking stars out there. The H-R = diagram for a galaxy 8Gly away would look substantially different than th= e usual, local one. Serious changes over time lie at least 12Gy in the pa= st, where the phase transitions and symmetry breaking of the hypothetical= big bang would have occurred. There *is* a hint of these transitions, in= the form of the well-known microwave background radiation.

Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0004_01C0DD21.AD0948E0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Just a not= e: we can't detect it only because it does not emit light that
>we = can see.
 
If we can't detect it why do we kno= w it's there?
We *can* detect it, inasmuch as we can infer its= presence. But detecting lots of things is done fairly indirectly. Extras= olar planets, for one.
 
>Dark matter *coul= d* just be ordinary, cold matter, and we
>would never be able to se= e it...from earth.  If we can ever get out into
>the galaxy an= d universe, THEN we'd probably have no problem detecting it.
&= nbsp;
If we even recognized it. We might even trip over it. Ch= eck out the Robert Sawyer novel Starplex. You can tell it's one of his ea= rly novels because of the creeping featurism, but it's still damn good.
>So we *know* Newton is a 'special case' version of the full law= s of
>motion.
 
More an approximation fo= r low velocities and low masses/tides.

>On the other hand, a gr= eat deal of modern physics is based on the fact
>(or more properly,= assumption) that the laws of the universe are true
>throughout the= universe.  This assumption has been explored in a variety
>of= ways, and largely seems to be taken as fact.

>But who knows wh= at really lies across the dark void, eh?
 
The= re is evidence that the fine structure "constant", at the very least, isn= 't; it varies over time or space very slightly. Major differenc= es in the laws, however, can be ruled out to ~12Gly. A qualitative c= hange in physical laws would create an opaque or *very* odd transition zo= ne and probably can't exist. Serious quantitative variations in the nucle= ar force and electromagnetic force coupling values would manifest in= the character of distant stars; there'd be *very* weird looking stars ou= t there. The H-R diagram for a galaxy 8Gly away would look substantially = different than the usual, local one. Serious changes over time lie at lea= st 12Gy in the past, where the phase transitions and symmetry breaking of= the hypothetical big bang would have occurred. There *is* a hint of thes= e transitions, in the form of the well-known microwave background radiati= on.

 


Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0004_01C0DD21.AD0948E0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: C-FOTD 22-04-01 Date: 15 May 2001 10:50:11 -0400 ------=_NextPart_001_0006_01C0DD2C.D2434F60 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Rambling story, flying heads, men in diapers, topless women -- it has ev= erything. Topless women? In the Wizard of Oz?! Someone is spinning in his/her grave= . Decent old sci-fi movies I've seen: The Fly and friends (the three old ones, not the 80s remakes -- those are= good too but not *old*!) 2001 (a bit slow in places) A Crack in the World (cheesy, I know) Forbin: The Colossus Project (parts of it suck, but the rest...) Star Wars: ANH(!) The Terminal Man The Andromeda Strain Decent 80s: Tron 2010 Anything Short Circuit Star Wars: ESB, ROJ Star Trek: TMP (a bit slow in places) Star Trek 2, 4, 6(? -- might have been early 90s) Starman, Last Starfighter, assorted other Starfoo Moonraker (hey, it had a freaking big [and unrealistic] space station!) Assorted Superman movies and spinoffs (why the *hell* did they stop makin= g these?) The Fly (1985 remake) and probably its sequel (which I've never managed t= o see) Back to the Freaking Future! (and sequels -- let's see if these b*stards = can do 90!) Cocoon and sequels, *Batteries Not Included (oh, crap, I'm turning into a= sap!) John Carpenter's Village of the Damned (or was that late 70s?) Original shrunk the kids (the sequels sucked, and the TV show blows) Decent modern ones: Phantom Menace (duh) Mission to Mars (ymmv) Stargate (obscure; the TV show rocks too and is still in production), ID4 Armageddon, Deep Impact (so the science in Armageddon sucked. It was stil= l fun.) Jurassic Park (but the sequel sucked) Goldeneye (hey, it had funky nuclear weapons!) X-Men Lost In Space Any recent Star Trek movie (with Picard and crew!) -- especially the ones= with the azz-kicking Enterprise E. Especially the last one. Any film that depicts an older woman as desirabl= e gets bonus points. Special edition Star Wars ROJ and ANH! Aliens (nice explosion near the end -- too bad the sequel sucked. The pre= quel is too old for this list.) The Abyss (often overlooked, *cool* music) Sphere (It *did* come from the Creighton-meister) Event Horizon (Not for the faint of heart -- if you use nitroglycerine fo= r something other than blowing things up, I recommend Aliens instead. J/k...) Starship Troopers (WARNING: Take one (1) Pepto-Bismol before viewing. Avo= id viewing in an aircraft, motor vehicle, elevator, ship*, or other moving vehicle, or dur= ing an earthquake. Avoid viewing while on a waterbed. =20 Keep a pail handy, preferably one that is easy t= o wash. *Spacecraft are an exception, except during an e= ngine burn.) Recent ones I haven't seen, but that look good: Supernova Red Planet (not to confuse with Mission to Mars) Alien 4 Titan: AE(!) DVD special edition version of ST:TMP (obscure) Less sure about: Deep Blue Sea Battlefield: Earth Up-and-coming and guaranteed good: Star Wars II (duh) Star Trek X (duh) Star Wars III (don't hold your breath) Rumored: A Matrix sequel or prequel (*drool*) DVD Recommended due to digital FX and widescreen: Star Trek 9 (duh) Phantom Menace (duh! don't have it but it *has* to rock!) The Matrix (check out the whole last third -- also loads of extras on the= disk) Armageddon (if you hate the Eiffel Tower you'll love the DVD version of t= his) Deep Impact (probably; don't have it) Star Wars: ANH, ROJ -- the explosion of the ROJ Death Star really suffers= on pan-and-scan, although the pan-and-scan version of the sail barge explosion scen= e is more impressive because of the dramatic panning! ID4 (duh! the small screen really wrecks the impressive alien ship arriva= l scene! then there's the massive fights, explosions, &c) Stargate (probably; don't have it) Supernova and Titan: AE (probably; don't have either on DVD or VHS) Stuff that sucked: The Food of the Gods The Day of the Triffids (a crying shame; the book rocks) Any of several bad Frankenstein rip-offs from the 60s, 70s, and 80s Any of several bad Dracula rip-offs from the 60s, 70s, and 80s* Asteroid! (this one made Armageddon look scientifically accurate!) * RHPS excluded, special exemption OK: Screamers Downdraft Star Trek 3, 5 Space Cowboys The Arrival The Arrival II (probably -- got a DVD of it, but haven't gotten around to= viewing it yet) Good spoofs: Spaceballs! Galaxy Quest The Zero Wing flash animation(!)* The movie was good but the book sucked: * Several of the Star Trek movies * Someone set up us the Zerowing reference!

Get Your P= rivate, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0006_01C0DD2C.D2434F60 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Rambling s= tory, flying heads, men in diapers, topless women -- it has everything.
 
Topless women? In the Wizard of Oz?! Someone = is spinning in his/her grave.
 
Decent old sci= -fi movies I've seen:
The Fly and friends (the three old ones,= not the 80s remakes -- those are good too but not *old*!)
200= 1 (a bit slow in places)
A Crack in the World (cheesy, I know)=
Forbin: The Colossus Project (parts of it suck, but the rest.= ..)
Star Wars: ANH(!)
The Terminal Man
T= he Andromeda Strain
Decent 80s:
Tron
2010
Anything Short Circuit
Star Wars: ESB, ROJ
=
Star Trek: TMP (a bit slow in places)
Star Trek 2, 4, 6(?= -- might have been early 90s)
Starman, Last Starfighter, asso= rted other Starfoo
Moonraker (hey, it had a freaking big [and = unrealistic] space station!)
Assorted Superman movies and spin= offs (why the *hell* did they stop making these?)
The Fly (198= 5 remake) and probably its sequel (which I've never managed to see)
=
Back to the Freaking Future! (and sequels -- let's see if these b*s= tards can do 90!)
Cocoon and sequels, *Batteries Not Included = (oh, crap, I'm turning into a sap!)
John Carpenter's Village o= f the Damned (or was that late 70s?)
Original shrunk the kids = (the sequels sucked, and the TV show blows)
Decent modern= ones:
Phantom Menace (duh)
Mission to Mars (ymmv)<= /DIV>
Stargate (obscure; the TV show rocks too and is still in produ= ction), ID4
Armageddon, Deep Impact (so the science in Armaged= don sucked. It was still fun.)
Jurassic Park (but the sequel s= ucked)
Goldeneye (hey, it had funky nuclear weapons!)
X-Men
Lost In Space
Any recent Star Trek movie (= with Picard and crew!) -- especially the ones with the azz-kicking Enterp= rise E.
Especially the last one. Any film that depicts an olde= r woman as desirable gets bonus points.
Special edition Star W= ars ROJ and ANH!
Aliens (nice explosion near the end -- too ba= d the sequel sucked. The prequel is too old for this list.)
Th= e Abyss (often overlooked, *cool* music)
Sphere (It *did* come= from the Creighton-meister)
Event Horizon (Not for the faint = of heart -- if you use nitroglycerine for something other than blowing th= ings up,
         = ;           I recommend= Aliens instead. J/k...)
Starship Troopers (WARNING: Take one = (1) Pepto-Bismol before viewing. Avoid viewing in an aircraft, motor vehi= cle,
         &nb= sp;           &nbs= p;   elevator, ship*, or other moving vehicle, or during an ear= thquake. Avoid viewing while on a waterbed.
   = ;            =           Keep a pail handy,= preferably one that is easy to wash.
    =             &= nbsp;        *Spacecraft are an e= xception, except during an engine burn.)
Recent ones I haven't= seen, but that look good:
Supernova
Red Planet (no= t to confuse with Mission to Mars)
Alien 4
Titan: A= E(!)
DVD special edition version of ST:TMP (obscure)
Less sure about:
Deep Blue Sea
Battlefield: Earth=
Up-and-coming and guaranteed good:
Star Wars II (d= uh)
Star Trek X (duh)
Star Wars III (don't hol= d your breath)
Rumored:
A Matrix sequel or prequel = (*drool*)
 
DVD Recommended due to digital FX = and widescreen:
Star Trek 9 (duh)
Phantom Menace (d= uh! don't have it but it *has* to rock!)
The Matrix (check out= the whole last third -- also loads of extras on the disk)
Arm= ageddon (if you hate the Eiffel Tower you'll love the DVD version of this= )
Deep Impact (probably; don't have it)
Star Wars: = ANH, ROJ -- the explosion of the ROJ Death Star really suffers on pan-and= -scan, although the pan-and-scan
     = ;            =             &= nbsp;   version of the sail barge explosion scene is more impre= ssive because of the dramatic panning!
ID4 (duh! the smal= l screen really wrecks the impressive alien ship arrival scene! then ther= e's the massive fights, explosions,
     &= amp;c)
Stargate (probably; don't have it)
Supernova= and Titan: AE (probably; don't have either on DVD or VHS)
&nb= sp;
 
Stuff that sucked:
The Food o= f the Gods
The Day of the Triffids (a crying shame; the book r= ocks)
Any of several bad Frankenstein rip-offs from the 60s, 7= 0s, and 80s
Any of several bad Dracula rip-offs from the= 60s, 70s, and 80s*
Asteroid! (this one made Armageddon look s= cientifically accurate!)
 
* RHPS excluded, sp= ecial exemption
 
OK:
Screame= rs
Downdraft
Star Trek 3, 5
Space Cowboy= s
The Arrival
The Arrival II (probably -- got a DVD= of it, but haven't gotten around to viewing it yet)
 
Good spoofs:
Spaceballs!
Galaxy Quest
The Zero Wing flash animation(!)*
 
The= movie was good but the book sucked:
* Several of the Star Tre= k movies
 
 
 
* Someone set up us the Zerowing reference!

=

Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0006_01C0DD2C.D2434F60-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 02-05-01 (Heads Up Mister Midget [7]) Date: 15 May 2001 11:02:20 -0400 ------=_NextPart_001_0007_01C0DD2E.83F9E380 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Although it has only 256 colors, the bands are almost >invisible, resulting in a GIF image as close to the appearance >of true-color as one is likely to see. The neighborhood optometrist is your friend. Seriously, I can perceive every contour into the purple area. Looks like = "true-color" is a *slight* exaggeration :)

Get Your Pr= ivate, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0007_01C0DD2E.83F9E380 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Although i= t has only 256 colors, the bands are almost
>invisible, resulting i= n a GIF image as close to the appearance
>of true-color as one is l= ikely to see.
 
The neighborhood optometrist i= s your friend.
 
Seriously, I can perceive eve= ry contour into the purple area. Looks like "true-color" is a *slight* ex= aggeration :)
 

<= br clear=3Dall>
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0007_01C0DD2E.83F9E380-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: bmc1@airmail.net Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 12:00:03 -0500 --------------99D18BFEEFF4B82A915730FC Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Hey Multiple- Interesting comments re dark matter, physics @ >12Gly, etc. What's your academic background? DBF Multiple Bogeys wrote: > >Just a note: we can't detect it only because it does not emit light > that > >we can see. If we can't detect it why do we know it's there?We *can* > detect it, inasmuch as we can infer its presence. But detecting lots > of things is done fairly indirectly. Extrasolar planets, for > one. >Dark matter *could* just be ordinary, cold matter, and we > >would never be able to see it...from earth. If we can ever get out > into > >the galaxy and universe, THEN we'd probably have no problem detecting > it. If we even recognized it. We might even trip over it. Check out > the Robert Sawyer novel Starplex. You can tell it's one of his early > novels because of the creeping featurism, but it's still damn good. > > >So we *know* Newton is a 'special case' version of the full laws of > >motion. More an approximation for low velocities and low > masses/tides. > > >On the other hand, a great deal of modern physics is based on the > fact > >(or more properly, assumption) that the laws of the universe are true > > >throughout the universe. This assumption has been explored in a > variety > >of ways, and largely seems to be taken as fact. > > >But who knows what really lies across the dark void, eh? There is > evidence that the fine structure "constant", at the very least, isn't; > it varies over time or space very slightly. Major differences in the > laws, however, can be ruled out to ~12Gly. A qualitative change in > physical laws would create an opaque or *very* odd transition zone and > probably can't exist. Serious quantitative variations in the nuclear > force and electromagnetic force coupling values would manifest in the > character of distant stars; there'd be *very* weird looking stars out > there. The H-R diagram for a galaxy 8Gly away would look substantially > different than the usual, local one. Serious changes over time lie at > least 12Gy in the past, where the phase transitions and symmetry > breaking of the hypothetical big bang would have occurred. There *is* > a hint of these transitions, in the form of the well-known microwave > background radiation. > > ----------------------------------------------------------------------- > Get Your Private, Free E-mail from MSN Hotmail at > http://www.hotmail.com. --------------99D18BFEEFF4B82A915730FC Content-Type: text/html; charset=us-ascii Content-Transfer-Encoding: 7bit Hey Multiple-

Interesting comments re dark matter, physics @ >12Gly, etc.

What's your academic background?

DBF

Multiple Bogeys wrote:

>Just a note: we can't detect it only because it does not emit light that
>we can see. If we can't detect it why do we know it's there?We *can* detect it, inasmuch as we can infer its presence. But detecting lots of things is done fairly indirectly. Extrasolar planets, for one. >Dark matter *could* just be ordinary, cold matter, and we
>would never be able to see it...from earth.  If we can ever get out into
>the galaxy and universe, THEN we'd probably have no problem detecting it. If we even recognized it. We might even trip over it. Check out the Robert Sawyer novel Starplex. You can tell it's one of his early novels because of the creeping featurism, but it's still damn good.

>So we *know* Newton is a 'special case' version of the full laws of
>motion. More an approximation for low velocities and low masses/tides.

>On the other hand, a great deal of modern physics is based on the fact
>(or more properly, assumption) that the laws of the universe are true
>throughout the universe.  This assumption has been explored in a variety
>of ways, and largely seems to be taken as fact.

>But who knows what really lies across the dark void, eh? There is evidence that the fine structure "constant", at the very least, isn't; it varies over time or space very slightly. Major differences in the laws, however, can be ruled out to ~12Gly. A qualitative change in physical laws would create an opaque or *very* odd transition zone and probably can't exist. Serious quantitative variations in the nuclear force and electromagnetic force coupling values would manifest in the character of distant stars; there'd be *very* weird looking stars out there. The H-R diagram for a galaxy 8Gly away would look substantially different than the usual, local one. Serious changes over time lie at least 12Gy in the past, where the phase transitions and symmetry breaking of the hypothetical big bang would have occurred. There *is* a hint of these transitions, in the form of the well-known microwave background radiation.  


Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.
--------------99D18BFEEFF4B82A915730FC-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 16:26:08 -0400 ------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > Some astronomers have suggested that dark matter might be located in > (and I love this term) MACHOS (MAssive Cometary Halo ObjectS). That > is, really, really big snowballs. With rocks in them. ;-) MAssive Compact Halo Objects, actually. And besides cometoids, they can b= e rogue planets, brown dwarfs, no-longer-luminous collapsed stars (cooled= white dwarf, cooled neutron star, black hole far from other mass). Also, the mainstream, inflationary cosmology requires some non-baryonic d= ark matter. Incidentally, wouldn't it be a hoot if globular clusters turned out to be= *artifacts*? Think of it -- scads of energy, and if they have no or slow= FTL (e.g. weeks to cross a light year) their systems are all close toget= her. Massive engineering feat though. Now, you know what would be even mo= re impressive? If some ubercivilizations have locked up their globular cl= usters in dyson shells. Makes the usual dyson shell look like a shanty on= the side of the highway by comparison. And the result is dark matter, wi= th maybe the odd infrared glow somewhere. Intriguingly, these clusters are in slow gravitational collapse. An inter= esting possibility is that this is what someone did in order to open worm= holes for intergalactic travel... the stars fall into the center, some gr= avitational magic, presto! Open a bridge to Andromeda. Anyone doing somet= hing like that takes a *looong* view. Probably have to be uploads then.
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> Some astr= onomers have suggested that dark matter might be located in
> (and = I love this term) MACHOS (MAssive Cometary Halo ObjectS).  That
&= gt; is, really, really big snowballs.  With rocks in them.  ;-)=
MAssive Compact Halo Objects, actually. And besides comet= oids, they can be rogue planets, brown dwarfs, no-longer-luminous collaps= ed stars (cooled white dwarf, cooled neutron star, black hole far from ot= her mass).
 
Also, the mainstream, inflationar= y cosmology requires some non-baryonic dark matter.
 
Incidentally, wouldn't it be a hoot if globular clusters turned o= ut to be *artifacts*? Think of it -- scads of energy, and if they have no= or slow FTL (e.g. weeks to cross a light year) their systems are all clo= se together. Massive engineering feat though. Now, you know what would be= even more impressive? If some ubercivilizations have locked up their glo= bular clusters in dyson shells. Makes the usual dyson shell look like a s= hanty on the side of the highway by comparison. And the result is dark ma= tter, with maybe the odd infrared glow somewhere.
 
=
Intriguingly, these clusters are in slow gravitational collapse. An= interesting possibility is that this is what someone did in order to ope= n wormholes for intergalactic travel... the stars fall into the center, s= ome gravitational magic, presto! Open a bridge to Andromeda. Anyone doing= something like that takes a *looong* view. Probably have to be uploads t= hen.



Get Your Private, Fr= ee E-mail from MSN Hotmail at http://w= ww.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 16:26:08 -0400 ------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > Some astronomers have suggested that dark matter might be located in > (and I love this term) MACHOS (MAssive Cometary Halo ObjectS). That > is, really, really big snowballs. With rocks in them. ;-) MAssive Compact Halo Objects, actually. And besides cometoids, they can b= e rogue planets, brown dwarfs, no-longer-luminous collapsed stars (cooled= white dwarf, cooled neutron star, black hole far from other mass). Also, the mainstream, inflationary cosmology requires some non-baryonic d= ark matter. Incidentally, wouldn't it be a hoot if globular clusters turned out to be= *artifacts*? Think of it -- scads of energy, and if they have no or slow= FTL (e.g. weeks to cross a light year) their systems are all close toget= her. Massive engineering feat though. Now, you know what would be even mo= re impressive? If some ubercivilizations have locked up their globular cl= usters in dyson shells. Makes the usual dyson shell look like a shanty on= the side of the highway by comparison. And the result is dark matter, wi= th maybe the odd infrared glow somewhere. Intriguingly, these clusters are in slow gravitational collapse. An inter= esting possibility is that this is what someone did in order to open worm= holes for intergalactic travel... the stars fall into the center, some gr= avitational magic, presto! Open a bridge to Andromeda. Anyone doing somet= hing like that takes a *looong* view. Probably have to be uploads then.
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> Some astr= onomers have suggested that dark matter might be located in
> (and = I love this term) MACHOS (MAssive Cometary Halo ObjectS).  That
&= gt; is, really, really big snowballs.  With rocks in them.  ;-)=
MAssive Compact Halo Objects, actually. And besides comet= oids, they can be rogue planets, brown dwarfs, no-longer-luminous collaps= ed stars (cooled white dwarf, cooled neutron star, black hole far from ot= her mass).
 
Also, the mainstream, inflationar= y cosmology requires some non-baryonic dark matter.
 
Incidentally, wouldn't it be a hoot if globular clusters turned o= ut to be *artifacts*? Think of it -- scads of energy, and if they have no= or slow FTL (e.g. weeks to cross a light year) their systems are all clo= se together. Massive engineering feat though. Now, you know what would be= even more impressive? If some ubercivilizations have locked up their glo= bular clusters in dyson shells. Makes the usual dyson shell look like a s= hanty on the side of the highway by comparison. And the result is dark ma= tter, with maybe the odd infrared glow somewhere.
 
=
Intriguingly, these clusters are in slow gravitational collapse. An= interesting possibility is that this is what someone did in order to ope= n wormholes for intergalactic travel... the stars fall into the center, s= ome gravitational magic, presto! Open a bridge to Andromeda. Anyone doing= something like that takes a *looong* view. Probably have to be uploads t= hen.



Get Your Private, Fr= ee E-mail from MSN Hotmail at http://w= ww.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 16:29:59 -0400 ------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Hey Multiple- =20 >Interesting comments re dark matter, physics @ >12Gly, etc. =20 >What's your academic background? Officially? 5 credits short of a bachelor's in computers and math. Unofficially? I know something about everything and a lot more than the a= verage B.S. in some subjects.

Get Your Private, Free E= -mail from MSN Hotmail at http://www.h= otmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Hey Multip= le-
 
>Interesting comments re dark matter= , physics @ >12Gly, etc.
 
>What's your= academic background?
 
Officially? 5 credits = short of a bachelor's in computers and math.
Unofficially? I k= now something about everything and a lot more than the average = B.S. in some subjects.


<= hr>Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 16:26:08 -0400 ------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > Some astronomers have suggested that dark matter might be located in > (and I love this term) MACHOS (MAssive Cometary Halo ObjectS). That > is, really, really big snowballs. With rocks in them. ;-) MAssive Compact Halo Objects, actually. And besides cometoids, they can b= e rogue planets, brown dwarfs, no-longer-luminous collapsed stars (cooled= white dwarf, cooled neutron star, black hole far from other mass). Also, the mainstream, inflationary cosmology requires some non-baryonic d= ark matter. Incidentally, wouldn't it be a hoot if globular clusters turned out to be= *artifacts*? Think of it -- scads of energy, and if they have no or slow= FTL (e.g. weeks to cross a light year) their systems are all close toget= her. Massive engineering feat though. Now, you know what would be even mo= re impressive? If some ubercivilizations have locked up their globular cl= usters in dyson shells. Makes the usual dyson shell look like a shanty on= the side of the highway by comparison. And the result is dark matter, wi= th maybe the odd infrared glow somewhere. Intriguingly, these clusters are in slow gravitational collapse. An inter= esting possibility is that this is what someone did in order to open worm= holes for intergalactic travel... the stars fall into the center, some gr= avitational magic, presto! Open a bridge to Andromeda. Anyone doing somet= hing like that takes a *looong* view. Probably have to be uploads then.
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> Some astr= onomers have suggested that dark matter might be located in
> (and = I love this term) MACHOS (MAssive Cometary Halo ObjectS).  That
&= gt; is, really, really big snowballs.  With rocks in them.  ;-)=
MAssive Compact Halo Objects, actually. And besides comet= oids, they can be rogue planets, brown dwarfs, no-longer-luminous collaps= ed stars (cooled white dwarf, cooled neutron star, black hole far from ot= her mass).
 
Also, the mainstream, inflationar= y cosmology requires some non-baryonic dark matter.
 
Incidentally, wouldn't it be a hoot if globular clusters turned o= ut to be *artifacts*? Think of it -- scads of energy, and if they have no= or slow FTL (e.g. weeks to cross a light year) their systems are all clo= se together. Massive engineering feat though. Now, you know what would be= even more impressive? If some ubercivilizations have locked up their glo= bular clusters in dyson shells. Makes the usual dyson shell look like a s= hanty on the side of the highway by comparison. And the result is dark ma= tter, with maybe the odd infrared glow somewhere.
 
=
Intriguingly, these clusters are in slow gravitational collapse. An= interesting possibility is that this is what someone did in order to ope= n wormholes for intergalactic travel... the stars fall into the center, s= ome gravitational magic, presto! Open a bridge to Andromeda. Anyone doing= something like that takes a *looong* view. Probably have to be uploads t= hen.



Get Your Private, Fr= ee E-mail from MSN Hotmail at http://w= ww.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 16:26:08 -0400 ------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > Some astronomers have suggested that dark matter might be located in > (and I love this term) MACHOS (MAssive Cometary Halo ObjectS). That > is, really, really big snowballs. With rocks in them. ;-) MAssive Compact Halo Objects, actually. And besides cometoids, they can b= e rogue planets, brown dwarfs, no-longer-luminous collapsed stars (cooled= white dwarf, cooled neutron star, black hole far from other mass). Also, the mainstream, inflationary cosmology requires some non-baryonic d= ark matter. Incidentally, wouldn't it be a hoot if globular clusters turned out to be= *artifacts*? Think of it -- scads of energy, and if they have no or slow= FTL (e.g. weeks to cross a light year) their systems are all close toget= her. Massive engineering feat though. Now, you know what would be even mo= re impressive? If some ubercivilizations have locked up their globular cl= usters in dyson shells. Makes the usual dyson shell look like a shanty on= the side of the highway by comparison. And the result is dark matter, wi= th maybe the odd infrared glow somewhere. Intriguingly, these clusters are in slow gravitational collapse. An inter= esting possibility is that this is what someone did in order to open worm= holes for intergalactic travel... the stars fall into the center, some gr= avitational magic, presto! Open a bridge to Andromeda. Anyone doing somet= hing like that takes a *looong* view. Probably have to be uploads then.
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> Some astr= onomers have suggested that dark matter might be located in
> (and = I love this term) MACHOS (MAssive Cometary Halo ObjectS).  That
&= gt; is, really, really big snowballs.  With rocks in them.  ;-)=
MAssive Compact Halo Objects, actually. And besides comet= oids, they can be rogue planets, brown dwarfs, no-longer-luminous collaps= ed stars (cooled white dwarf, cooled neutron star, black hole far from ot= her mass).
 
Also, the mainstream, inflationar= y cosmology requires some non-baryonic dark matter.
 
Incidentally, wouldn't it be a hoot if globular clusters turned o= ut to be *artifacts*? Think of it -- scads of energy, and if they have no= or slow FTL (e.g. weeks to cross a light year) their systems are all clo= se together. Massive engineering feat though. Now, you know what would be= even more impressive? If some ubercivilizations have locked up their glo= bular clusters in dyson shells. Makes the usual dyson shell look like a s= hanty on the side of the highway by comparison. And the result is dark ma= tter, with maybe the odd infrared glow somewhere.
 
=
Intriguingly, these clusters are in slow gravitational collapse. An= interesting possibility is that this is what someone did in order to ope= n wormholes for intergalactic travel... the stars fall into the center, s= ome gravitational magic, presto! Open a bridge to Andromeda. Anyone doing= something like that takes a *looong* view. Probably have to be uploads t= hen.



Get Your Private, Fr= ee E-mail from MSN Hotmail at http://w= ww.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 16:29:59 -0400 ------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Hey Multiple- =20 >Interesting comments re dark matter, physics @ >12Gly, etc. =20 >What's your academic background? Officially? 5 credits short of a bachelor's in computers and math. Unofficially? I know something about everything and a lot more than the a= verage B.S. in some subjects.

Get Your Private, Free E= -mail from MSN Hotmail at http://www.h= otmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Hey Multip= le-
 
>Interesting comments re dark matter= , physics @ >12Gly, etc.
 
>What's your= academic background?
 
Officially? 5 credits = short of a bachelor's in computers and math.
Unofficially? I k= now something about everything and a lot more than the average = B.S. in some subjects.


<= hr>Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 06-05-01 (A Hazy Mandelbrot [4]) Date: 15 May 2001 17:08:51 -0400 ------=_NextPart_001_0002_01C0DD61.B79C1680 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > As I watched the image slowly take shape, I wondered about the > infinite logarithmic spiral, of which today's scene is an > infinitesimal part. Of what dimension is it? My first guess > would be that it is five-dimensional, since every twist is four- > dimensional. But I'm not at all sure that my guess is right. > In fact, the spiral might be of a fractional dimension. The Riemann surface? Any fractal dimension you choose to name -> dimensio= n 2 (it's smooth). The smallest Euclidean embedding manifold that doesn't= force unnatural self-intersections: 3-dimensional. The graph itself? From C to the Riemann surface, straightforward multival= ued projection up and down onto the surface, so the surface *is* the grap= h.

Get Your Private, Free E-mail from MSN Hotmail at <= a href=3D"http://www.hotmail.com">http://www.hotmail.com.

------=_NextPart_001_0002_01C0DD61.B79C1680 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> As I watc= hed the image slowly take shape, I wondered about the
> infinite lo= garithmic spiral, of which today's scene is an
> infinitesimal part= .  Of what dimension is it?  My first guess
> would be th= at it is five-dimensional, since every twist is four-
> dimensional= .  But I'm not at all sure that my guess is right.
> In fact, = the spiral might be of a fractional dimension.
The Riemann= surface? Any fractal dimension you choose to name -> dimension 2= (it's smooth). The smallest Euclidean embedding manifold that doesn't fo= rce unnatural self-intersections: 3-dimensional.
The graph its= elf? From C to the Riemann surface, straightforward multivalued projectio= n up and down onto the surface, so the surface *is* the graph.



Get Your Private, Free E-mail from = MSN Hotmail at http://www.hotmail.com<= /a>.

------=_NextPart_001_0002_01C0DD61.B79C1680-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 06-05-01 (A Hazy Mandelbrot [4]) Date: 15 May 2001 17:08:51 -0400 ------=_NextPart_001_0002_01C0DD61.B79C1680 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > As I watched the image slowly take shape, I wondered about the > infinite logarithmic spiral, of which today's scene is an > infinitesimal part. Of what dimension is it? My first guess > would be that it is five-dimensional, since every twist is four- > dimensional. But I'm not at all sure that my guess is right. > In fact, the spiral might be of a fractional dimension. The Riemann surface? Any fractal dimension you choose to name -> dimensio= n 2 (it's smooth). The smallest Euclidean embedding manifold that doesn't= force unnatural self-intersections: 3-dimensional. The graph itself? From C to the Riemann surface, straightforward multival= ued projection up and down onto the surface, so the surface *is* the grap= h.

Get Your Private, Free E-mail from MSN Hotmail at <= a href=3D"http://www.hotmail.com">http://www.hotmail.com
.

------=_NextPart_001_0002_01C0DD61.B79C1680 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> As I watc= hed the image slowly take shape, I wondered about the
> infinite lo= garithmic spiral, of which today's scene is an
> infinitesimal part= .  Of what dimension is it?  My first guess
> would be th= at it is five-dimensional, since every twist is four-
> dimensional= .  But I'm not at all sure that my guess is right.
> In fact, = the spiral might be of a fractional dimension.
The Riemann= surface? Any fractal dimension you choose to name -> dimension 2= (it's smooth). The smallest Euclidean embedding manifold that doesn't fo= rce unnatural self-intersections: 3-dimensional.
The graph its= elf? From C to the Riemann surface, straightforward multivalued projectio= n up and down onto the surface, so the surface *is* the graph.



Get Your Private, Free E-mail from = MSN Hotmail at http://www.hotmail.com<= /a>.

------=_NextPart_001_0002_01C0DD61.B79C1680-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 16:26:08 -0400 ------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > Some astronomers have suggested that dark matter might be located in > (and I love this term) MACHOS (MAssive Cometary Halo ObjectS). That > is, really, really big snowballs. With rocks in them. ;-) MAssive Compact Halo Objects, actually. And besides cometoids, they can b= e rogue planets, brown dwarfs, no-longer-luminous collapsed stars (cooled= white dwarf, cooled neutron star, black hole far from other mass). Also, the mainstream, inflationary cosmology requires some non-baryonic d= ark matter. Incidentally, wouldn't it be a hoot if globular clusters turned out to be= *artifacts*? Think of it -- scads of energy, and if they have no or slow= FTL (e.g. weeks to cross a light year) their systems are all close toget= her. Massive engineering feat though. Now, you know what would be even mo= re impressive? If some ubercivilizations have locked up their globular cl= usters in dyson shells. Makes the usual dyson shell look like a shanty on= the side of the highway by comparison. And the result is dark matter, wi= th maybe the odd infrared glow somewhere. Intriguingly, these clusters are in slow gravitational collapse. An inter= esting possibility is that this is what someone did in order to open worm= holes for intergalactic travel... the stars fall into the center, some gr= avitational magic, presto! Open a bridge to Andromeda. Anyone doing somet= hing like that takes a *looong* view. Probably have to be uploads then.
Get Your Private, Free E-mail from MSN Hotmail at
http://www.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> Some astr= onomers have suggested that dark matter might be located in
> (and = I love this term) MACHOS (MAssive Cometary Halo ObjectS).  That
&= gt; is, really, really big snowballs.  With rocks in them.  ;-)=
MAssive Compact Halo Objects, actually. And besides comet= oids, they can be rogue planets, brown dwarfs, no-longer-luminous collaps= ed stars (cooled white dwarf, cooled neutron star, black hole far from ot= her mass).
 
Also, the mainstream, inflationar= y cosmology requires some non-baryonic dark matter.
 
Incidentally, wouldn't it be a hoot if globular clusters turned o= ut to be *artifacts*? Think of it -- scads of energy, and if they have no= or slow FTL (e.g. weeks to cross a light year) their systems are all clo= se together. Massive engineering feat though. Now, you know what would be= even more impressive? If some ubercivilizations have locked up their glo= bular clusters in dyson shells. Makes the usual dyson shell look like a s= hanty on the side of the highway by comparison. And the result is dark ma= tter, with maybe the odd infrared glow somewhere.
 
=
Intriguingly, these clusters are in slow gravitational collapse. An= interesting possibility is that this is what someone did in order to ope= n wormholes for intergalactic travel... the stars fall into the center, s= ome gravitational magic, presto! Open a bridge to Andromeda. Anyone doing= something like that takes a *looong* view. Probably have to be uploads t= hen.



Get Your Private, Fr= ee E-mail from MSN Hotmail at http://w= ww.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 16:29:59 -0400 ------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Hey Multiple- =20 >Interesting comments re dark matter, physics @ >12Gly, etc. =20 >What's your academic background? Officially? 5 credits short of a bachelor's in computers and math. Unofficially? I know something about everything and a lot more than the a= verage B.S. in some subjects.

Get Your Private, Free E= -mail from MSN Hotmail at http://www.h= otmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Hey Multip= le-
 
>Interesting comments re dark matter= , physics @ >12Gly, etc.
 
>What's your= academic background?
 
Officially? 5 credits = short of a bachelor's in computers and math.
Unofficially? I k= now something about everything and a lot more than the average = B.S. in some subjects.


<= hr>Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 08-05-01 (A Riot of Color [6]) Date: 15 May 2001 17:41:08 -0400 ------=_NextPart_001_0003_01C0DD66.39CB4780 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Classic FOTD -- May 08, 2001 (Rating 6) ^ You misspelled '8'. Keep up the good work! :-)

Get Your Private, Free E-ma= il from MSN Hotmail at http://www.hotm= ail.com.

------=_NextPart_001_0003_01C0DD66.39CB4780 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Classic FO= TD -- May 08, 2001 (Rating 6)
      &nbs= p;            = ;            =             &= nbsp;         ^
Y= ou misspelled '8'.
 
Keep up the good work! :-= )



Get Your Private, Free = E-mail from MSN Hotmail at http://www.= hotmail.com.

------=_NextPart_001_0003_01C0DD66.39CB4780-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 06-05-01 (A Hazy Mandelbrot [4]) Date: 15 May 2001 17:08:51 -0400 ------=_NextPart_001_0002_01C0DD61.B79C1680 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > As I watched the image slowly take shape, I wondered about the > infinite logarithmic spiral, of which today's scene is an > infinitesimal part. Of what dimension is it? My first guess > would be that it is five-dimensional, since every twist is four- > dimensional. But I'm not at all sure that my guess is right. > In fact, the spiral might be of a fractional dimension. The Riemann surface? Any fractal dimension you choose to name -> dimensio= n 2 (it's smooth). The smallest Euclidean embedding manifold that doesn't= force unnatural self-intersections: 3-dimensional. The graph itself? From C to the Riemann surface, straightforward multival= ued projection up and down onto the surface, so the surface *is* the grap= h.

Get Your Private, Free E-mail from MSN Hotmail at <= a href=3D"http://www.hotmail.com">http://www.hotmail.com.

------=_NextPart_001_0002_01C0DD61.B79C1680 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> As I watc= hed the image slowly take shape, I wondered about the
> infinite lo= garithmic spiral, of which today's scene is an
> infinitesimal part= .  Of what dimension is it?  My first guess
> would be th= at it is five-dimensional, since every twist is four-
> dimensional= .  But I'm not at all sure that my guess is right.
> In fact, = the spiral might be of a fractional dimension.
The Riemann= surface? Any fractal dimension you choose to name -> dimension 2= (it's smooth). The smallest Euclidean embedding manifold that doesn't fo= rce unnatural self-intersections: 3-dimensional.
The graph its= elf? From C to the Riemann surface, straightforward multivalued projectio= n up and down onto the surface, so the surface *is* the graph.



Get Your Private, Free E-mail from = MSN Hotmail at http://www.hotmail.com<= /a>.

------=_NextPart_001_0002_01C0DD61.B79C1680-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 08-05-01 (A Riot of Color [6]) Date: 15 May 2001 17:41:08 -0400 ------=_NextPart_001_0003_01C0DD66.39CB4780 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Classic FOTD -- May 08, 2001 (Rating 6) ^ You misspelled '8'. Keep up the good work! :-)

Get Your Private, Free E-ma= il from MSN Hotmail at
http://www.hotm= ail.com.

------=_NextPart_001_0003_01C0DD66.39CB4780 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Classic FO= TD -- May 08, 2001 (Rating 6)
      &nbs= p;            = ;            =             &= nbsp;         ^
Y= ou misspelled '8'.
 
Keep up the good work! :-= )



Get Your Private, Free = E-mail from MSN Hotmail at http://www.= hotmail.com.

------=_NextPart_001_0003_01C0DD66.39CB4780-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 16:26:08 -0400 ------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > Some astronomers have suggested that dark matter might be located in > (and I love this term) MACHOS (MAssive Cometary Halo ObjectS). That > is, really, really big snowballs. With rocks in them. ;-) MAssive Compact Halo Objects, actually. And besides cometoids, they can b= e rogue planets, brown dwarfs, no-longer-luminous collapsed stars (cooled= white dwarf, cooled neutron star, black hole far from other mass). Also, the mainstream, inflationary cosmology requires some non-baryonic d= ark matter. Incidentally, wouldn't it be a hoot if globular clusters turned out to be= *artifacts*? Think of it -- scads of energy, and if they have no or slow= FTL (e.g. weeks to cross a light year) their systems are all close toget= her. Massive engineering feat though. Now, you know what would be even mo= re impressive? If some ubercivilizations have locked up their globular cl= usters in dyson shells. Makes the usual dyson shell look like a shanty on= the side of the highway by comparison. And the result is dark matter, wi= th maybe the odd infrared glow somewhere. Intriguingly, these clusters are in slow gravitational collapse. An inter= esting possibility is that this is what someone did in order to open worm= holes for intergalactic travel... the stars fall into the center, some gr= avitational magic, presto! Open a bridge to Andromeda. Anyone doing somet= hing like that takes a *looong* view. Probably have to be uploads then.
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> Some astr= onomers have suggested that dark matter might be located in
> (and = I love this term) MACHOS (MAssive Cometary Halo ObjectS).  That
&= gt; is, really, really big snowballs.  With rocks in them.  ;-)=
MAssive Compact Halo Objects, actually. And besides comet= oids, they can be rogue planets, brown dwarfs, no-longer-luminous collaps= ed stars (cooled white dwarf, cooled neutron star, black hole far from ot= her mass).
 
Also, the mainstream, inflationar= y cosmology requires some non-baryonic dark matter.
 
Incidentally, wouldn't it be a hoot if globular clusters turned o= ut to be *artifacts*? Think of it -- scads of energy, and if they have no= or slow FTL (e.g. weeks to cross a light year) their systems are all clo= se together. Massive engineering feat though. Now, you know what would be= even more impressive? If some ubercivilizations have locked up their glo= bular clusters in dyson shells. Makes the usual dyson shell look like a s= hanty on the side of the highway by comparison. And the result is dark ma= tter, with maybe the odd infrared glow somewhere.
 
=
Intriguingly, these clusters are in slow gravitational collapse. An= interesting possibility is that this is what someone did in order to ope= n wormholes for intergalactic travel... the stars fall into the center, s= ome gravitational magic, presto! Open a bridge to Andromeda. Anyone doing= something like that takes a *looong* view. Probably have to be uploads t= hen.



Get Your Private, Fr= ee E-mail from MSN Hotmail at http://w= ww.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 16:29:59 -0400 ------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Hey Multiple- =20 >Interesting comments re dark matter, physics @ >12Gly, etc. =20 >What's your academic background? Officially? 5 credits short of a bachelor's in computers and math. Unofficially? I know something about everything and a lot more than the a= verage B.S. in some subjects.

Get Your Private, Free E= -mail from MSN Hotmail at http://www.h= otmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Hey Multip= le-
 
>Interesting comments re dark matter= , physics @ >12Gly, etc.
 
>What's your= academic background?
 
Officially? 5 credits = short of a bachelor's in computers and math.
Unofficially? I k= now something about everything and a lot more than the average = B.S. in some subjects.


<= hr>Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: (fractint) And I thought *duplicates* were bad. Date: 15 May 2001 18:57:27 -0400 ------=_NextPart_001_0000_01C0DD70.E273F620 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable Woah. Looks like the listserver coughed up a hairball. One of my own post= ings has somehow been reproduced to *five copies*. Then again, I had some= weird Hotmail error trying to send that one, so it might be that Hotmail= b00gered up. Or some weird software laser between hotmail and the listse= rver. I hope it doesn't cause too much trouble or inconvenience...

Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0000_01C0DD70.E273F620 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable


Woah. = Looks like the listserver coughed up a hairball. One of my own postings h= as somehow been reproduced to *five copies*. Then again, I had some weird= Hotmail error trying to send that one, so it might be that Hotmail b00ge= red up. Or some weird software laser between hotmail and the listserver.<= /DIV>
 
I hope it doesn't cause too much trouble or = inconvenience...



Get Your= Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0000_01C0DD70.E273F620-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: David Boddington Subject: (fractint) Multiple Boogeys Date: 15 May 2001 16:05:15 -0700 Why are we getting multiple Multiple Boogeys? Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: (fractint) Bogeys on Movies Date: 16 May 2001 19:04:37 +1200 At 02:50 16/05/2001, Multiple Bogeys wrote: >Decent old [and recent] sci-fi movies I've seen: >... I'd add Scanners and Contact. >Stuff that sucked: The War of the Worlds (the George Pal ripoff - whatever that more recent thing was is just beneath contempt). I pray for a Peter Jackson remake that actually follows the novel. Morgan L. Owens "Michael Ironside giving you the evil eye." Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: (fractint) Bogeys on Movies Date: 16 May 2001 19:04:37 +1200 At 02:50 16/05/2001, Multiple Bogeys wrote: >Decent old [and recent] sci-fi movies I've seen: >... I'd add Scanners and Contact. >Stuff that sucked: The War of the Worlds (the George Pal ripoff - whatever that more recent thing was is just beneath contempt). I pray for a Peter Jackson remake that actually follows the novel. Morgan L. Owens "Michael Ironside giving you the evil eye." Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 16-05-01 (Patches of Color [7]) Date: 16 May 2001 10:14:52 -0400 (EDT) Classic FOTD -- May 16, 2001 (Rating 7) Fractal visionaries and enthusiasts: With today's image we return to the classic Mandelbrot set, but we return to it in a special way. The M-set comes in many versions, determined in one aspect by the bailout value. The bailout has a great effect on the outer bands, but as long as the bailout value is 4 or greater, the differences in the basic inner detail are small. However, with a bailout of less than 4, strange things start to happen. To start, the M-set is simply not all there. The tip of the negative stem is the first to be cut off. As the bailout is further reduced, more and more of the set becomes cut off, and the part that remains becomes ever more distorted. The closer to the bailout radius a feature lies, the more that feature is distorted. The distortion is of the type seen around midgets that lie near -2 on the negative stem when the bailout value is 4. This effect of fingers pointing inward toward the midget is not an inherent characteristic of midgets far out on the negative stem; it is due entirely to the closeness of the midgets to the bailout radius. This same finger effect appears in nearly all parts of the M-set when those parts lie very near the escape radius, and sometimes it takes most interesting variations. The midget in today's image, which lies on the filament extending from the north bud, is very near the cutoff point, giving the appearance of a midget on the negative stem. Because the scene contains so many areas of flat color, I named it "Patches of Color". I rendered the scene with classic outside equal-iteration bands after trying the other outside options, and discovering that the result was pretty much the same. I rated the image a 7, which, considering the simplicity of the scene, is perhaps a bit optimistic. But it's a pleasant thing to view, and worth its rating. Since the magnitude of the image is in the arbitrary precision range, the parameter file is a slow one, taking all of 1/2 hour to render on my tired old Pentium 200mhz machine. It will render in far less time on one of the speedier newer models. (No, I am not trying to sell computers. This is simply a statement of fact.) For those who decide not to run the parameter file, the GIF image will soon be available on the Web at: and: when Paul and Scott have had a chance to render and post it. The fractal weather today was sunny and pleasant enough, though a bit chilly for May. The fractal cats approved of the 73F (23C) temperature by passing the afternoon in the grass of the yard. It's now 10am and time to get busy on other things. But I'll return tomorrow with a most unusual scene that Lee Skinner found in my "Pooped-Out" image. Until then, take care, and if fractals didn't exist, someone would have to invent them. Jim Muth jamth@mindspring.com START 20.0 PARAMETER FILE ================================= Patches_of_Color { ; time=0:34:50.52--SF5 on a p200 reset=2001 type=mandel passes=b center-mag=-0.016866288292003691049311636513915874\ /1.00548061034188650807845045625051303/6.126022e+0\ 31/1/-82.499 params=0/0 float=y maxiter=3200 bailout=2 inside=255 logmap=802 periodicity=10 colors=000H4KyWzvYztZyq_wAw34w0Rz0lf7zrDhuMLlV0db0\ MAFPKYRSpU`zVhzN_qHS_9L_3DR05L0IF0U80d20p00z74tG9l\ QFdZKZhPRqUKzYDwQ7vI0mA0v4Vw0zv7uuDmuLftRZrYRzzKqk\ Czz4yyIYiWPfhMZ`KSVHLNFFHC8APZdIbfCdfK`dRYcZUcfQbm\ NbqSduYgybhzgkzklvlplmrbnvSpyIqz8rz0rzUqzwqzvWziby\ YguLmq8rmHilP`lWSlSUhQVfNWbKY_HZWF_UC_RFUQGNPHHPKC\ NL5NM0MN0MV0I`4Gg9DbGNZLWVRdQWmMbvIgzNnwSupYzh`zbV\ zZPtWKlUDdR7YP2RM9YRGcWNi`UndZRKb30Z84WD8SIDQNHMSM\ KYQIbMHgIFlFDqACv7Az39z0Cz4Du8FnDGiHIdLKZQLUUMNZPI\ bQDfR7kS2nU0rV4tWCtYKtZQt_Yt`dt`ktZirYiqVipNiiUipR\ inQimRywQvuQvtQmrPpqPfpPkn0zK4zP8zSCuYFq`InfMlizVK\ zWMzYPwZRt_Up`WlbZic_fdbbfdZggVhiRilwKmrNmmRmhVmcZ\ mZbmUfm2PM4RP5SR8UU9WVAYYDZ_F``HbcIcfKfgMgiNhlR7NQ\ LWPYdm0Kk3Mi5Nh8QgCRdFUcHVbLY`NZZQ`YUbWWdVZfSbhRdi\ Qgl0wW0vY2uZ4t_5r`8rb9qcCpdDnfGmgHmhKliLkkNilk`0hb\ 0fc4cd9`dG_fLYgRVgYShb000 } END 20.0 PARAMETER FILE =================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Bogeys on Movies Date: 16 May 2001 19:17:04 -0400 ------=_NextPart_001_0000_01C0DE3C.CADF26C0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > I'd add Scanners and Contact. D'oh! Forgot Contact on good recent ones.

Get Your Private, = Free E-mail from MSN Hotmail at http:/= /www.hotmail.com.

------=_NextPart_001_0000_01C0DE3C.CADF26C0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> I'd add S= canners and Contact.
<hits self on head>
= D'oh!
Forgot Contact on good recent ones.
<= DIV>


Get Your Private, Free E-mail from MSN Hotmai= l at http://www.hotmail.com.
------=_NextPart_001_0000_01C0DE3C.CADF26C0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 17-05-01 (Patches of Color [NA]) Date: 17 May 2001 09:44:11 -0400 (EDT) Classic FOTD -- May 17, 2001 (Rating NA) Fractal visionaries and enthusiasts: In the "All Pooped Out" notes of 2 days ago, I commented that the image was not a midget in a larger fractal -- it was the entire fractal. I made the statement without examining the rest of the fractal. I should know better than to say such absolute things about fractals, but I thought that in this particular case the statement was true. It should come as no surprise that I was mistaken. Shortly after posting the image, I received a note from Lee Skinner pointing out that the "Pooped Out" image was not the whole fractal. To illustrate, he included a parameter file of a scene well off to the left (no politics involved) of the 'pooped off' area. The image is one of the more unusual ones that I have seen in my years of wandering the world of fractals. Lee named it "Numbers", and I have kept the name. It takes little imagination to see the numbers scattered throughout the scene, which are even in a decorative font. In fact, the numbers' font seems to be the same one as the dates on the 'cat-a-day' calendar on my desk. Studying the image, I see 2's, 5's, 7's, 6's, 9's, as well as bits and pieces of the remaining 5 numerals. I did not rate the image, since I rarely rate the fractals of others. But it is apparent that if I had rated it, the rating would be above a 5. The parameter file is slow, requiring almost 1/2 hour to render, but for relief the image will soon be available for download on the W.W.Web at: and at: The WWW still has not been technically perfected, so don't be put off by a glitch or hang-up. With its sun and temperature of 71F (21.5C), the fractal weather was ideal again today. In fact, it has been too ideal lately. The local farmers are beginning to complain about the dryness. The cats however are not complaining. Once again they spent most of the day romping and resting in the yard. As for me, it's past 9am and the time I should start my more serious endeavors. So until next time, take care, and when I was a boy, I wanted to grow up to be a scientist, but now that I'm grown up I'm not even sure what a scientist is. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Numbers { ; image by Lee Skinner - time=0:28:10.54 reset=2001 type=formula formulafile=allinone.par formulaname=MandelbrotMix4 function=recip passes=t center-mag=+0.0178871706298102/-0.010051504509756/\ 2.678973e+007/1/135 params=1/0.7/-1/-0.7/-4.5/5000 float=y maxiter=5000 inside=0 logmap=415 periodicity=10 colors=000zR7zS7zU7zV7zW6zY6zZ6z_6z`5zb5zc5ye4yf5y\ g5yg6yh6yi7yj7yk8yl8yl9ym9ynAyoBypCyqDyrDyrEysEysJ\ ytPytUytZytdytiyuoyutzvzxvzvuytuyruypuxmtxktwitwgt\ wesvcsvasv_suYsuWrtUrtRqsQpsPosPorOnrOnrNmrMmqMlqL\ lqLkpKkpJjpJjpIioIioHhoGgnGgnFfnEfnEemDemDdmCdlBcl\ BclAblAbk9ak9`k8`k7_k7_j6Zj5Yi5Yf6Yb6Y_7YW7YS8XP8X\ L9XH9XEAXABW6AY68_67a65c54f32h20k00j01h12g13e23c34\ b35`46_47Y58X58V69U6AS7CS7ER7GR7IQ7KP7MO7OO7QN7SM7\ UL8VL8WL9WL9XL9YL9ZL9_L9`LAaLAbKBcMDdOFeQIfSKgUNhW\ PiYRkZUl`WmbYnd`ofbpheqjgrlisnktpnurpvtswvukrpZmkN\ ifAda8d_6cX4cV2bS0aP7bOFdNNfLVgKbiIjjGrlFznDzmEzkF\ zjGzhHzgIzeJzdKzbLzaMz_NzZOzXPzWRzUSzTTzRUzQVzOWzN\ XzLYzKZzI_zH`zFazEbzCczBdz9ez8fz6gz5hz3jz3lz2oz2rz\ EtzQuzawzmxzzztwuntogqjandVkZOhTIeNBbHDcHFcHHdHJdG\ LeGNeGPfGRfGTgGVgGXhFZhF`iFbiFdjFfjFhkEjkEllEnlEpm\ DrmDtnDvnDxoDzpCznBzlAzj8 } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 17-05-01 (Numbers [NA]) Date: 17 May 2001 10:59:51 EDT Classic FOTD -- May 17, 2001 (Rating NA) Fractal visionaries and enthusiasts: In the "All Pooped Out" notes of 2 days ago, I commented that the image was not a midget in a larger fractal -- it was the entire fractal. I made the statement without examining the rest of the fractal. I should know better than to say such absolute things about fractals, but I thought that in this particular case the statement was true. It should come as no surprise that I was mistaken. Shortly after posting the image, I received a note from Lee Skinner pointing out that the "Pooped Out" image was not the whole fractal. To illustrate, he included a parameter file of a scene well off to the left (no politics involved) of the 'pooped off' area. The image is one of the more unusual ones that I have seen in my years of wandering the world of fractals. Lee named it "Numbers", and I have kept the name. It takes little imagination to see the numbers scattered throughout the scene, which are even in a decorative font. In fact, the numbers' font seems to be the same one as the dates on the 'cat-a-day' calendar on my desk. Studying the image, I see 2's, 5's, 7's, 6's, 9's, as well as bits and pieces of the remaining 5 numerals. I did not rate the image, since I rarely rate the fractals of others. But it is apparent that if I had rated it, the rating would be above a 5. The parameter file is slow, requiring almost 1/2 hour to render, but for relief the image will soon be available for download on the W.W.Web at: and at: The WWW still has not been technically perfected, so don't be put off by a glitch or hang-up. With its sun and temperature of 71F (21.5C), the fractal weather was ideal again today. In fact, it has been too ideal lately. The local farmers are beginning to complain about the dryness. The cats however are not complaining. Once again they spent most of the day romping and resting in the yard. As for me, it's past 9am and the time I should start my more serious endeavors. So until next time, take care, and when I was a boy, I wanted to grow up to be a scientist, but now that I'm grown up I'm not even sure what a scientist is. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Numbers { ; image by Lee Skinner - time=0:28:10.54 reset=2001 type=formula formulafile=allinone.par formulaname=MandelbrotMix4 function=recip passes=t center-mag=+0.0178871706298102/-0.010051504509756/\ 2.678973e+007/1/135 params=1/0.7/-1/-0.7/-4.5/5000 float=y maxiter=5000 inside=0 logmap=415 periodicity=10 colors=000zR7zS7zU7zV7zW6zY6zZ6z_6z`5zb5zc5ye4yf5y\ g5yg6yh6yi7yj7yk8yl8yl9ym9ynAyoBypCyqDyrDyrEysEysJ\ ytPytUytZytdytiyuoyutzvzxvzvuytuyruypuxmtxktwitwgt\ wesvcsvasv_suYsuWrtUrtRqsQpsPosPorOnrOnrNmrMmqMlqL\ lqLkpKkpJjpJjpIioIioHhoGgnGgnFfnEfnEemDemDdmCdlBcl\ BclAblAbk9ak9`k8`k7_k7_j6Zj5Yi5Yf6Yb6Y_7YW7YS8XP8X\ L9XH9XEAXABW6AY68_67a65c54f32h20k00j01h12g13e23c34\ b35`46_47Y58X58V69U6AS7CS7ER7GR7IQ7KP7MO7OO7QN7SM7\ UL8VL8WL9WL9XL9YL9ZL9_L9`LAaLAbKBcMDdOFeQIfSKgUNhW\ PiYRkZUl`WmbYnd`ofbpheqjgrlisnktpnurpvtswvukrpZmkN\ ifAda8d_6cX4cV2bS0aP7bOFdNNfLVgKbiIjjGrlFznDzmEzkF\ zjGzhHzgIzeJzdKzbLzaMz_NzZOzXPzWRzUSzTTzRUzQVzOWzN\ XzLYzKZzI_zH`zFazEbzCczBdz9ez8fz6gz5hz3jz3lz2oz2rz\ EtzQuzawzmxzzztwuntogqjandVkZOhTIeNBbHDcHFcHHdHJdG\ LeGNeGPfGRfGTgGVgGXhFZhF`iFbiFdjFfjFhkEjkEllEnlEpm\ DrmDtnDvnDxoDzpCznBzlAzj8 } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Programmer Dude Subject: Re: (fractint) float only version Date: 17 May 2001 10:26:43 -0500 > George Priest wrote: > Could I install the float-only version in the same directory with the > regular version and rename it something like FractinF? Well,... you should probably name it "FractFlo".... -- |_ CJSonnack _____________| How's my programming? | |_ http://www.Sonnack.com/ ___________________| Call: 1-800-DEV-NULL | |_____________________________________________|_______________________| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Thierry B." Subject: Re: (fractint) float only version Date: 17 May 2001 15:33:13 +0000 Programmer Dude wrote: > > > George Priest wrote: > > > Could I install the float-only version in the same directory with the > > regular version and rename it something like FractinF? > > Well,... you should probably name it "FractFlo".... > what a good idea ! my girl-friend was named Flo ! http://la.buvette.org/images/photos/flo.euh -- Thierry, 42++ Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: =?iso-8859-1?Q?Francisco_Andeyro_Garc=EDa?= Subject: (fractint) Hi, little problem with first formulas... Date: 17 May 2001 17:41:23 +0200 Dear Friends: My name is Francisco Andeyro. I'm a student at the polytechnic of Madrid, and a fractal and mathematics enthusiast, like you all. I'm doing some research in Graphic cryptography, with some algorithms, similar to automatas. All technical info is avaible at: http://www.arkion.es But the problem i have, has nothing to do with that. I'm doing my first steps in managing formula fractals. As a first simple exercise i decided to write a formula file for representing a simple Mandelbrot: MandelPrueba {;Quicote z0=c=pixel z=z*z+c } And it draws something very similar to a mandel, but irregular and broken; and i got really surprised when i turn on Floating Point... and i obtained an empty blue screen... I've run also MandelPrueba {;Quicote z0=c=pixel z=z*z+c |z|<4 } With similar result. I'm sure that it has an obvious explanation, ...but i'm young and unexperinced... Please help me I'm using Fractint 20.0. Thanks in advance. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: George Martin Subject: (fractint) Hi, little problem with first formulas... Date: 17 May 2001 13:29:50 -0400 MandelPrueba {;Quicote z0=3Dc=3Dpixel z=3Dz*z+c } This formula lacks the "bailout" line at the end. Also, you do not need = a separate variable (z0) in the initialization. Finally, the initializati= on section should be separated from the main body of the formula with a ":".= The complete formula Mandelbrot { z =3D c =3D pixel: z =3D z*z + c |z| < 4 } George Martin = Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Guy Marson Subject: Re: (fractint) Hi, little problem with first formulas... Date: 17 May 2001 22:50:09 +0200 At 17:41 17/05/01 +0200, you wrote: >Dear Friends: Try it this way: **********************************************=20 MandelPrueba {;Quicote z=3Dc=3Dpixel ;the ':' is a must.. : z=3Dz*z+c and a bailout condition:=20 =A6z=A6<=3D4 } *********************************** > >And it draws something very similar to a mandel, but irregular and broken; >and i got really surprised when i turn on Floating Point... and i obtained >an empty blue screen... > >I've run also > >MandelPrueba {;Quicote >z0=3Dc=3Dpixel >z=3Dz*z+c >|z|<4 >} > >With similar result. > >I'm sure that it has an obvious explanation, ...but i'm young and >unexperinced... Please help me > >I'm using Fractint 20.0. > >Thanks in advance. > cheers,=20 Guy Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 16:26:08 -0400 ------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > Some astronomers have suggested that dark matter might be located in > (and I love this term) MACHOS (MAssive Cometary Halo ObjectS). That > is, really, really big snowballs. With rocks in them. ;-) MAssive Compact Halo Objects, actually. And besides cometoids, they can b= e rogue planets, brown dwarfs, no-longer-luminous collapsed stars (cooled= white dwarf, cooled neutron star, black hole far from other mass). Also, the mainstream, inflationary cosmology requires some non-baryonic d= ark matter. Incidentally, wouldn't it be a hoot if globular clusters turned out to be= *artifacts*? Think of it -- scads of energy, and if they have no or slow= FTL (e.g. weeks to cross a light year) their systems are all close toget= her. Massive engineering feat though. Now, you know what would be even mo= re impressive? If some ubercivilizations have locked up their globular cl= usters in dyson shells. Makes the usual dyson shell look like a shanty on= the side of the highway by comparison. And the result is dark matter, wi= th maybe the odd infrared glow somewhere. Intriguingly, these clusters are in slow gravitational collapse. An inter= esting possibility is that this is what someone did in order to open worm= holes for intergalactic travel... the stars fall into the center, some gr= avitational magic, presto! Open a bridge to Andromeda. Anyone doing somet= hing like that takes a *looong* view. Probably have to be uploads then.
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> Some astr= onomers have suggested that dark matter might be located in
> (and = I love this term) MACHOS (MAssive Cometary Halo ObjectS).  That
&= gt; is, really, really big snowballs.  With rocks in them.  ;-)=
MAssive Compact Halo Objects, actually. And besides comet= oids, they can be rogue planets, brown dwarfs, no-longer-luminous collaps= ed stars (cooled white dwarf, cooled neutron star, black hole far from ot= her mass).
 
Also, the mainstream, inflationar= y cosmology requires some non-baryonic dark matter.
 
Incidentally, wouldn't it be a hoot if globular clusters turned o= ut to be *artifacts*? Think of it -- scads of energy, and if they have no= or slow FTL (e.g. weeks to cross a light year) their systems are all clo= se together. Massive engineering feat though. Now, you know what would be= even more impressive? If some ubercivilizations have locked up their glo= bular clusters in dyson shells. Makes the usual dyson shell look like a s= hanty on the side of the highway by comparison. And the result is dark ma= tter, with maybe the odd infrared glow somewhere.
 
=
Intriguingly, these clusters are in slow gravitational collapse. An= interesting possibility is that this is what someone did in order to ope= n wormholes for intergalactic travel... the stars fall into the center, s= ome gravitational magic, presto! Open a bridge to Andromeda. Anyone doing= something like that takes a *looong* view. Probably have to be uploads t= hen.



Get Your Private, Fr= ee E-mail from MSN Hotmail at http://w= ww.hotmail.com.

------=_NextPart_001_0000_01C0DD5B.BFB8DDE0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 08-05-01 (A Riot of Color [6]) Date: 15 May 2001 17:41:08 -0400 ------=_NextPart_001_0003_01C0DD66.39CB4780 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Classic FOTD -- May 08, 2001 (Rating 6) ^ You misspelled '8'. Keep up the good work! :-)

Get Your Private, Free E-ma= il from MSN Hotmail at http://www.hotm= ail.com.

------=_NextPart_001_0003_01C0DD66.39CB4780 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Classic FO= TD -- May 08, 2001 (Rating 6)
      &nbs= p;            = ;            =             &= nbsp;         ^
Y= ou misspelled '8'.
 
Keep up the good work! :-= )



Get Your Private, Free = E-mail from MSN Hotmail at http://www.= hotmail.com.

------=_NextPart_001_0003_01C0DD66.39CB4780-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: =?iso-8859-1?Q?Francisco_Andeyro_Garc=EDa?= Subject: (fractint) ...another little... doubt... Date: 18 May 2001 12:52:03 +0200 ...it works much better with your help... Thanks to George Martin and Guy Marson... Now i have another doubt. I'm doing some research in graphic cryptography with a kind of automata developed by me. It generates beautifull images similar to fractals... but i never know if it can be considered as fractal or not... I supose, it is fractal, because it generates images with similar patterns at diferent scale... and it do it with an algorithm that is not very diferent from a Langton ant, or cellular automatas...(not also very very similar, but not too diferent). All technical info, and images are avaible at my web: http://www.arkion.es ...it would be nice to know what you all think about it... Thanks in advance. Francisco Andeyro This formula lacks the "bailout" line at the end. Also, you do not need a separate variable (z0) in the initialization. Finally, the initialization section should be separated from the main body of the formula with a ":". The complete formula Mandelbrot { z = c = pixel: z = z*z + c |z| < 4 } George Martin Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 18-05-01 (Too Much of It All [4]) Date: 18 May 2001 09:12:44 -0400 (EDT) Classic FOTD -- May 18, 2001 (Rating 4) Fractal visionaries and enthusiasts: Today's FOTD rates a modest 4, which is a little below average. The rating is this low because the image has too much of everything. To begin, the parameter file takes over 3 hours to render, which is far too much time for an image of such questionable worth. I would strongly recommend letting Paul and Scott do the rendering. When they have done the work, the image will be available in a few hours on their FOTD web sites at: and at: Why did I choose a mediocre 3-hour image to be today's FOTD? The answer is simple -- at first I thought it would be a prize- winner. The 1/10-size thumbnail, which took 18 minutes to render, looked spectacular with a different color palette. But when the full-size image was finished, it fell far short of its promise. The original palette, which looked so good on a small size image, didn't work at all with the full-sized version, and the image just wouldn't look right regardless of how much I tweaked the colors. Eventually, I discarded the original colors and substituted the present palette. The image is a difficult one to color because it has too much detail. The colors just don't blend pleasingly. And when the colors do blend, the detail vanishes. A great fractal may lie hidden in the image, waiting only for a clever color scheme to reveal it, but the image is simply too slow to try the various rendering options. I named the image "Too Much of It All", which is an honest description of my feelings about the image. I found the scene when I did a little extra exploring of the "Pooped-Out" fractal of 3 days ago -- a fractal filled with unusual places just waiting to be discovered. In addition to iterated numbers, the weather is fractal in nature. Today, it was cloudy and chilly, with a temperature of 63F (17C). The cats, who are also fractal, decided it was a bit too cold, and were outdoors only a few minutes. But they were in an unusually pleasant mood for an indoor day. I'm waxing philosophical, but the wall clock tells me that the day is young and there's a lot to be done. The time has come to post my FOTD and get busy. Until next time, take care, and with an infinity of midgets waiting to be discovered, the chance of any given midget being discovered is zero. Yet midgets are in fact discovered. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Too_Much_of_It_All { ; time=3:05:48.77--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+0.0154933047329414/-0.0137267362945872\ /6.480949e+008/1/10 params=1/0.7/-1/-0.7/-4.5/5000 float=y maxiter=36000 inside=0 logmap=-2263 periodicity=10 colors=000c0zc0zc0zc0zc0zc1zZ3zZ6zZ7zU9zUAwUDrUFmU\ GhUJdULgUMjUOmUQpPSrKTuFXxAYz0_z0`z0_z0Yy0Xx0Vu0Tr\ 0Sp0Qm0Pj0Oi0Of0Mc0La0J_0IX0GV0FS0DP0CO0AL0000CL4C\ L9CMFCMJCOOCOTCPYCPaDPgDQlDQpDSvDSzDTzDTzDTzJPzOLz\ SGzYCza7zf3zl0zp0zu0zy0zu0zr6ugGpTQjF`f0jd0md7pVFd\ XTfYggYvi_zi`zj`zlazlczmczodzodzpfzrgzrgzsizujzujz\ vlzxmzxmzzozzozzlzzjzzgvzfrzdmzaiz`dzY`zXXzVSzSOzQ\ JzPFzMGzLGzJGzIIzFIzDIzCJzAJz7Jz6Jz4Lz3Lz0Lz0Mz0Mz\ 0Mz0MzFAzF0zF0zF0zF0zF0zF0zF0zF0zF0zF0zF0zF0zF0zF1\ zF3zF3zF4zD4z96z67z37z09z09z0Dz0Gz0Lz0Oz0Qz0Xz0az0\ gv1mo1sg1y`jxTauMVrFMo9Fv47z03z10z30z40z60z70z60z4\ 0z40z31z34z17z1Az0Dz0Gz0Jz0Mz0Pz0Sz0Vz0Yz0`z0cz0fz\ 0iz0lz0mz0jz0iz0gz0fz1cz4az6`z9_zCYzFVzITzLSzMQzPO\ zSMzVLzYJz`IzaDz_AzY7zX4zV1zT0zS0zQ0zS1zT4zT7zVAzX\ DzXFzYIz_Lz_Oz`QzaTzaXzcYzd`zdczffzgizglziozjpzjjz\ gdzf_zcTzaCz9Dz9FzAFzAGzA } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: George Martin Subject: (fractint) Hi, little problem with first formulas... Date: 17 May 2001 13:29:50 -0400 MandelPrueba {;Quicote z0=3Dc=3Dpixel z=3Dz*z+c } This formula lacks the "bailout" line at the end. Also, you do not need = a separate variable (z0) in the initialization. Finally, the initializati= on section should be separated from the main body of the formula with a ":".= The complete formula Mandelbrot { z =3D c =3D pixel: z =3D z*z + c |z| < 4 } George Martin = Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: C-FOTD 22-04-01 Date: 15 May 2001 10:50:11 -0400 ------=_NextPart_001_0006_01C0DD2C.D2434F60 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Rambling story, flying heads, men in diapers, topless women -- it has ev= erything. Topless women? In the Wizard of Oz?! Someone is spinning in his/her grave= . Decent old sci-fi movies I've seen: The Fly and friends (the three old ones, not the 80s remakes -- those are= good too but not *old*!) 2001 (a bit slow in places) A Crack in the World (cheesy, I know) Forbin: The Colossus Project (parts of it suck, but the rest...) Star Wars: ANH(!) The Terminal Man The Andromeda Strain Decent 80s: Tron 2010 Anything Short Circuit Star Wars: ESB, ROJ Star Trek: TMP (a bit slow in places) Star Trek 2, 4, 6(? -- might have been early 90s) Starman, Last Starfighter, assorted other Starfoo Moonraker (hey, it had a freaking big [and unrealistic] space station!) Assorted Superman movies and spinoffs (why the *hell* did they stop makin= g these?) The Fly (1985 remake) and probably its sequel (which I've never managed t= o see) Back to the Freaking Future! (and sequels -- let's see if these b*stards = can do 90!) Cocoon and sequels, *Batteries Not Included (oh, crap, I'm turning into a= sap!) John Carpenter's Village of the Damned (or was that late 70s?) Original shrunk the kids (the sequels sucked, and the TV show blows) Decent modern ones: Phantom Menace (duh) Mission to Mars (ymmv) Stargate (obscure; the TV show rocks too and is still in production), ID4 Armageddon, Deep Impact (so the science in Armageddon sucked. It was stil= l fun.) Jurassic Park (but the sequel sucked) Goldeneye (hey, it had funky nuclear weapons!) X-Men Lost In Space Any recent Star Trek movie (with Picard and crew!) -- especially the ones= with the azz-kicking Enterprise E. Especially the last one. Any film that depicts an older woman as desirabl= e gets bonus points. Special edition Star Wars ROJ and ANH! Aliens (nice explosion near the end -- too bad the sequel sucked. The pre= quel is too old for this list.) The Abyss (often overlooked, *cool* music) Sphere (It *did* come from the Creighton-meister) Event Horizon (Not for the faint of heart -- if you use nitroglycerine fo= r something other than blowing things up, I recommend Aliens instead. J/k...) Starship Troopers (WARNING: Take one (1) Pepto-Bismol before viewing. Avo= id viewing in an aircraft, motor vehicle, elevator, ship*, or other moving vehicle, or dur= ing an earthquake. Avoid viewing while on a waterbed. =20 Keep a pail handy, preferably one that is easy t= o wash. *Spacecraft are an exception, except during an e= ngine burn.) Recent ones I haven't seen, but that look good: Supernova Red Planet (not to confuse with Mission to Mars) Alien 4 Titan: AE(!) DVD special edition version of ST:TMP (obscure) Less sure about: Deep Blue Sea Battlefield: Earth Up-and-coming and guaranteed good: Star Wars II (duh) Star Trek X (duh) Star Wars III (don't hold your breath) Rumored: A Matrix sequel or prequel (*drool*) DVD Recommended due to digital FX and widescreen: Star Trek 9 (duh) Phantom Menace (duh! don't have it but it *has* to rock!) The Matrix (check out the whole last third -- also loads of extras on the= disk) Armageddon (if you hate the Eiffel Tower you'll love the DVD version of t= his) Deep Impact (probably; don't have it) Star Wars: ANH, ROJ -- the explosion of the ROJ Death Star really suffers= on pan-and-scan, although the pan-and-scan version of the sail barge explosion scen= e is more impressive because of the dramatic panning! ID4 (duh! the small screen really wrecks the impressive alien ship arriva= l scene! then there's the massive fights, explosions, &c) Stargate (probably; don't have it) Supernova and Titan: AE (probably; don't have either on DVD or VHS) Stuff that sucked: The Food of the Gods The Day of the Triffids (a crying shame; the book rocks) Any of several bad Frankenstein rip-offs from the 60s, 70s, and 80s Any of several bad Dracula rip-offs from the 60s, 70s, and 80s* Asteroid! (this one made Armageddon look scientifically accurate!) * RHPS excluded, special exemption OK: Screamers Downdraft Star Trek 3, 5 Space Cowboys The Arrival The Arrival II (probably -- got a DVD of it, but haven't gotten around to= viewing it yet) Good spoofs: Spaceballs! Galaxy Quest The Zero Wing flash animation(!)* The movie was good but the book sucked: * Several of the Star Trek movies * Someone set up us the Zerowing reference!

Get Your P= rivate, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0006_01C0DD2C.D2434F60 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Rambling s= tory, flying heads, men in diapers, topless women -- it has everything.
 
Topless women? In the Wizard of Oz?! Someone = is spinning in his/her grave.
 
Decent old sci= -fi movies I've seen:
The Fly and friends (the three old ones,= not the 80s remakes -- those are good too but not *old*!)
200= 1 (a bit slow in places)
A Crack in the World (cheesy, I know)=
Forbin: The Colossus Project (parts of it suck, but the rest.= ..)
Star Wars: ANH(!)
The Terminal Man
T= he Andromeda Strain
Decent 80s:
Tron
2010
Anything Short Circuit
Star Wars: ESB, ROJ
=
Star Trek: TMP (a bit slow in places)
Star Trek 2, 4, 6(?= -- might have been early 90s)
Starman, Last Starfighter, asso= rted other Starfoo
Moonraker (hey, it had a freaking big [and = unrealistic] space station!)
Assorted Superman movies and spin= offs (why the *hell* did they stop making these?)
The Fly (198= 5 remake) and probably its sequel (which I've never managed to see)
=
Back to the Freaking Future! (and sequels -- let's see if these b*s= tards can do 90!)
Cocoon and sequels, *Batteries Not Included = (oh, crap, I'm turning into a sap!)
John Carpenter's Village o= f the Damned (or was that late 70s?)
Original shrunk the kids = (the sequels sucked, and the TV show blows)
Decent modern= ones:
Phantom Menace (duh)
Mission to Mars (ymmv)<= /DIV>
Stargate (obscure; the TV show rocks too and is still in produ= ction), ID4
Armageddon, Deep Impact (so the science in Armaged= don sucked. It was still fun.)
Jurassic Park (but the sequel s= ucked)
Goldeneye (hey, it had funky nuclear weapons!)
X-Men
Lost In Space
Any recent Star Trek movie (= with Picard and crew!) -- especially the ones with the azz-kicking Enterp= rise E.
Especially the last one. Any film that depicts an olde= r woman as desirable gets bonus points.
Special edition Star W= ars ROJ and ANH!
Aliens (nice explosion near the end -- too ba= d the sequel sucked. The prequel is too old for this list.)
Th= e Abyss (often overlooked, *cool* music)
Sphere (It *did* come= from the Creighton-meister)
Event Horizon (Not for the faint = of heart -- if you use nitroglycerine for something other than blowing th= ings up,
         = ;           I recommend= Aliens instead. J/k...)
Starship Troopers (WARNING: Take one = (1) Pepto-Bismol before viewing. Avoid viewing in an aircraft, motor vehi= cle,
         &nb= sp;           &nbs= p;   elevator, ship*, or other moving vehicle, or during an ear= thquake. Avoid viewing while on a waterbed.
   = ;            =           Keep a pail handy,= preferably one that is easy to wash.
    =             &= nbsp;        *Spacecraft are an e= xception, except during an engine burn.)
Recent ones I haven't= seen, but that look good:
Supernova
Red Planet (no= t to confuse with Mission to Mars)
Alien 4
Titan: A= E(!)
DVD special edition version of ST:TMP (obscure)
Less sure about:
Deep Blue Sea
Battlefield: Earth=
Up-and-coming and guaranteed good:
Star Wars II (d= uh)
Star Trek X (duh)
Star Wars III (don't hol= d your breath)
Rumored:
A Matrix sequel or prequel = (*drool*)
 
DVD Recommended due to digital FX = and widescreen:
Star Trek 9 (duh)
Phantom Menace (d= uh! don't have it but it *has* to rock!)
The Matrix (check out= the whole last third -- also loads of extras on the disk)
Arm= ageddon (if you hate the Eiffel Tower you'll love the DVD version of this= )
Deep Impact (probably; don't have it)
Star Wars: = ANH, ROJ -- the explosion of the ROJ Death Star really suffers on pan-and= -scan, although the pan-and-scan
     = ;            =             &= nbsp;   version of the sail barge explosion scene is more impre= ssive because of the dramatic panning!
ID4 (duh! the smal= l screen really wrecks the impressive alien ship arrival scene! then ther= e's the massive fights, explosions,
     &= amp;c)
Stargate (probably; don't have it)
Supernova= and Titan: AE (probably; don't have either on DVD or VHS)
&nb= sp;
 
Stuff that sucked:
The Food o= f the Gods
The Day of the Triffids (a crying shame; the book r= ocks)
Any of several bad Frankenstein rip-offs from the 60s, 7= 0s, and 80s
Any of several bad Dracula rip-offs from the= 60s, 70s, and 80s*
Asteroid! (this one made Armageddon look s= cientifically accurate!)
 
* RHPS excluded, sp= ecial exemption
 
OK:
Screame= rs
Downdraft
Star Trek 3, 5
Space Cowboy= s
The Arrival
The Arrival II (probably -- got a DVD= of it, but haven't gotten around to viewing it yet)
 
Good spoofs:
Spaceballs!
Galaxy Quest
The Zero Wing flash animation(!)*
 
The= movie was good but the book sucked:
* Several of the Star Tre= k movies
 
 
 
* Someone set up us the Zerowing reference!

=

Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0006_01C0DD2C.D2434F60-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 02-05-01 (Heads Up Mister Midget [7]) Date: 15 May 2001 11:02:20 -0400 ------=_NextPart_001_0007_01C0DD2E.83F9E380 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Although it has only 256 colors, the bands are almost >invisible, resulting in a GIF image as close to the appearance >of true-color as one is likely to see. The neighborhood optometrist is your friend. Seriously, I can perceive every contour into the purple area. Looks like = "true-color" is a *slight* exaggeration :)

Get Your Pr= ivate, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0007_01C0DD2E.83F9E380 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Although i= t has only 256 colors, the bands are almost
>invisible, resulting i= n a GIF image as close to the appearance
>of true-color as one is l= ikely to see.
 
The neighborhood optometrist i= s your friend.
 
Seriously, I can perceive eve= ry contour into the purple area. Looks like "true-color" is a *slight* ex= aggeration :)
 

<= br clear=3Dall>
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0007_01C0DD2E.83F9E380-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Guy Marson Subject: Re: (fractint) float only version Date: 19 May 2001 01:34:20 +0200 At 15:33 17/05/01 +0000, you wrote: >Programmer Dude wrote: >> >> > George Priest wrote: >> >> > Could I install the float-only version in the same directory with the >> > regular version and rename it something like FractinF? >> >> Well,... you should probably name it "FractFlo".... >> Une histoire belge? > > what a good idea ! my girl-friend was named Flo ! > http://la.buvette.org/images/photos/flo.euh > > >-- >Thierry, 42++ Cheers, Guy Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Guy Marson Subject: Re: (fractint) ...another little... doubt... Date: 19 May 2001 01:34:55 +0200 Hi Francisco, At 12:52 18/05/01 +0200, you wrote: >...it works much better with your help... > >Thanks to George Martin and Guy Marson... > >Now i have another doubt. I'm doing some research in graphic cryptography >with a kind of automata developed by me. It generates beautifull images >similar to fractals... but i never know if it can be considered as fractal >or not... to get a good definition of fractals, please read the "fractint.doc" generated by fractint.exe itself when entering the following on the command line: 'fractint makedoc'. For a better understanding please read the "Frmtutor" which you can download at : http://www.fractint.org/ > >I supose, it is fractal, because it generates images with similar patterns >at diferent scale... and it do it with an algorithm that is not very >diferent from a Langton ant, or cellular automatas...(not also very very >similar, but not too diferent). > >All technical info, and images are avaible at my web: > >http://www.arkion.es I will see it later on.. cheers, Guy Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 18-05-01 (Too Much of It All [4]) Date: 18 May 2001 09:12:44 -0400 (EDT) Classic FOTD -- May 18, 2001 (Rating 4) Fractal visionaries and enthusiasts: Today's FOTD rates a modest 4, which is a little below average. The rating is this low because the image has too much of everything. To begin, the parameter file takes over 3 hours to render, which is far too much time for an image of such questionable worth. I would strongly recommend letting Paul and Scott do the rendering. When they have done the work, the image will be available in a few hours on their FOTD web sites at: and at: Why did I choose a mediocre 3-hour image to be today's FOTD? The answer is simple -- at first I thought it would be a prize- winner. The 1/10-size thumbnail, which took 18 minutes to render, looked spectacular with a different color palette. But when the full-size image was finished, it fell far short of its promise. The original palette, which looked so good on a small size image, didn't work at all with the full-sized version, and the image just wouldn't look right regardless of how much I tweaked the colors. Eventually, I discarded the original colors and substituted the present palette. The image is a difficult one to color because it has too much detail. The colors just don't blend pleasingly. And when the colors do blend, the detail vanishes. A great fractal may lie hidden in the image, waiting only for a clever color scheme to reveal it, but the image is simply too slow to try the various rendering options. I named the image "Too Much of It All", which is an honest description of my feelings about the image. I found the scene when I did a little extra exploring of the "Pooped-Out" fractal of 3 days ago -- a fractal filled with unusual places just waiting to be discovered. In addition to iterated numbers, the weather is fractal in nature. Today, it was cloudy and chilly, with a temperature of 63F (17C). The cats, who are also fractal, decided it was a bit too cold, and were outdoors only a few minutes. But they were in an unusually pleasant mood for an indoor day. I'm waxing philosophical, but the wall clock tells me that the day is young and there's a lot to be done. The time has come to post my FOTD and get busy. Until next time, take care, and with an infinity of midgets waiting to be discovered, the chance of any given midget being discovered is zero. Yet midgets are in fact discovered. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Too_Much_of_It_All { ; time=3:05:48.77--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=+0.0154933047329414/-0.0137267362945872\ /6.480949e+008/1/10 params=1/0.7/-1/-0.7/-4.5/5000 float=y maxiter=36000 inside=0 logmap=-2263 periodicity=10 colors=000c0zc0zc0zc0zc0zc1zZ3zZ6zZ7zU9zUAwUDrUFmU\ GhUJdULgUMjUOmUQpPSrKTuFXxAYz0_z0`z0_z0Yy0Xx0Vu0Tr\ 0Sp0Qm0Pj0Oi0Of0Mc0La0J_0IX0GV0FS0DP0CO0AL0000CL4C\ L9CMFCMJCOOCOTCPYCPaDPgDQlDQpDSvDSzDTzDTzDTzJPzOLz\ SGzYCza7zf3zl0zp0zu0zy0zu0zr6ugGpTQjF`f0jd0md7pVFd\ XTfYggYvi_zi`zj`zlazlczmczodzodzpfzrgzrgzsizujzujz\ vlzxmzxmzzozzozzlzzjzzgvzfrzdmzaiz`dzY`zXXzVSzSOzQ\ JzPFzMGzLGzJGzIIzFIzDIzCJzAJz7Jz6Jz4Lz3Lz0Lz0Mz0Mz\ 0Mz0MzFAzF0zF0zF0zF0zF0zF0zF0zF0zF0zF0zF0zF0zF0zF1\ zF3zF3zF4zD4z96z67z37z09z09z0Dz0Gz0Lz0Oz0Qz0Xz0az0\ gv1mo1sg1y`jxTauMVrFMo9Fv47z03z10z30z40z60z70z60z4\ 0z40z31z34z17z1Az0Dz0Gz0Jz0Mz0Pz0Sz0Vz0Yz0`z0cz0fz\ 0iz0lz0mz0jz0iz0gz0fz1cz4az6`z9_zCYzFVzITzLSzMQzPO\ zSMzVLzYJz`IzaDz_AzY7zX4zV1zT0zS0zQ0zS1zT4zT7zVAzX\ DzXFzYIz_Lz_Oz`QzaTzaXzcYzd`zdczffzgizglziozjpzjjz\ gdzf_zcTzaCz9Dz9FzAFzAGzA } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 19-05-01 (What Is It [7]) Date: 19 May 2001 10:48:51 -0400 (EDT) Classic FOTD -- May 19, 2001 (Rating 7) Fractal visionaries and enthusiasts: Sometimes I have a difficult time finding a fractal worthy of being declared FOTD. At other times I have a great fractal but can't find a name for it. Today's fractal falls in the second category. The image is not the best of all time, but it's good enough to rate a 7, which makes it above average. The problem was that I just couldn't think of a name for the image. Finally, in desperation, I named it "What Is It". The parent fractal, a Z^(2.07)+C Mandeloid, appears as a large bay with two main buds on the western shore. The scene of today's image lies somewhat back in the northern valley of the northern bud. Rather than consisting of one wedge, as proper valleys do, this valley consists of a multitude of wedges in bits and pieces, converging and combining into one main wedge. The whole thing is better seen than described. And the image is fast for a change! Instead of rendering in a ridiculous 3 hours, the parameter file of this one renders in 3 minutes, making the best way of viewing the scene a toss-up. For those who choose to go to the internet to see the image, the GIF file will soon be posted at the following URL's: and: I occasionally receive letters asking why I have not switched to the Ultrafractal program. I rarely find time to send the reply, which is simply that I like Fractint better; but while browsing the Fractal Art list a day or so ago, I was reminded of these letters. I noticed that the next Ultrafractal contest is opening for entries. Of course, not being an Ultrafractal user, and not liking contests, I have no intention of entering the contest, even though it has a sub-category for users of 'other' fractal programs. But I wonder why we never hear of a Fractint contest. As I recall, the first in this series of fractal-art contests *was* a Fractint contest, mainly because UF had not yet been released. Someone submitted a formula, and the contest was to see who could create the best fractal from this formula. I enjoyed that contest, and even entered several images. But even then it was apparent that many fractalists wanted multiple layers, which I fail to appreciate, and also more colors. Fractint formulas hundreds of lines long were common, as the users tried for better coloring. Some formulas even drew rudimentary, two-layer checkerboard images. When UF appeared, with its faster rendering, true color, unlimited layers and many transforms, the Fractint users who had seen fractals as a means of artistic expression embraced the new program, leaving Fractint largely to those who saw fractals as a manifestation of the abstract realm of numbers. I have UF in my computer. I even load it now and then. But I just can't get into it like I have been into Fractint for over 10 years. I feel no resentment toward UF for drawing away Fractint's users. UF is a great program that deserves the popularity it has found. I simply miss the early days of sending disks filled with images through the snail mail, along with messages that read "look what I found at these coordinates". Well, I see that I'm starting to ramble, so it's time to shift the fractal thoughts to other topics. But I can't end without reporting the all-unimportant weather. It was cloudy and 68F (20C) here today (Friday, the 18th). The cats approved of the conditions. I'll return in not too many hours with more fractal goodies. Until that golden moment arrives, take care, and what do you do with a drunken fractal? Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ What_Is_It { ; time=0:02:57.62--SF5 on a p200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotBC1 function=floor passes=1 center-mag=-0.61011930652051370/+0.654816245367828\ 30/15366.65/1/-42.5 params=2.07/0/0/0 float=y maxiter=1500 inside=0 logmap=53 periodicity=10 colors=00080NB2RF4XK6_O9dTBgXCl`GqeHtiJzmKzpPzrTzv\ Wzx`zzdxzfxtcsn`ngZiaVdVR_QOVJKQDGL6CG0BB0B68CJJEV\ XGggEstEzzEzzKzxRzsWzpbzkgzgnzbtz_yzVzzRzzVzzYzzbz\ zfzzizzlzzpzztzxxzfztOzl6ze09nzElzJlxOlqRjlXjfajad\ iViiQniLqgEwg9zg2ze0ze0ze0ze0z`0zW4zTEzOQzKazGkzCw\ w7zt4zxCzzKzzTzz`zzizzpzzjztgzndzi`zdYzYVzTRzOOzIK\ zDHz6Ez1Bz07z04z01z00z04q09i2Ea9KTIQLOVDX`4be0ij0g\ l0fl0dl2bl6alB_lGYlJXlOVlTTlXlsXzxXzzVzzTzzRzzQzzO\ zzNzzLzzJzzIzzIzzQzzXwzbszknzqkzxfzzbzz_zzazzbzzdz\ zfzzgzzgzzgzzizzizziyzixzktzkqzkpxlltljslgqlepg`gd\ WlaRqYOwDdz0sz0pz0lz0iz2ez4dz8`z9YzDVzERzIQzJMzNJz\ OGzRCzTBzVTzXizYyz_zzazzXzzTzzOzzLzzIzzDvz9pz4jz1d\ z0Yz0Tz0Mz0Hz0Kz0Oz0Rz4Vz8YzD`zGdzLgzOjzTnzXqz_Wza\ CzYHzXKzTOzRRzQVzNYzLbzIezGizElzBpz9sz8vz6tz4tz2sz\ 1sz0sz0qz0qz0pz0pz0pz0nz0nz0lz0lz0lz0jz0jz0jz2jz8j\ zBizGizJizNizRizVgz_gzTHz } frm:MandelbrotBC1 { ; by several Fractint users e=p1, a=imag(p2)+100 p=real(p2)+PI q=2*PI*fn1(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z| Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 16:29:59 -0400 ------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Hey Multiple- =20 >Interesting comments re dark matter, physics @ >12Gly, etc. =20 >What's your academic background? Officially? 5 credits short of a bachelor's in computers and math. Unofficially? I know something about everything and a lot more than the a= verage B.S. in some subjects.

Get Your Private, Free E= -mail from MSN Hotmail at
http://www.h= otmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Hey Multip= le-
 
>Interesting comments re dark matter= , physics @ >12Gly, etc.
 
>What's your= academic background?
 
Officially? 5 credits = short of a bachelor's in computers and math.
Unofficially? I k= now something about everything and a lot more than the average = B.S. in some subjects.


<= hr>Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 06-05-01 (A Hazy Mandelbrot [4]) Date: 15 May 2001 17:08:51 -0400 ------=_NextPart_001_0002_01C0DD61.B79C1680 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > As I watched the image slowly take shape, I wondered about the > infinite logarithmic spiral, of which today's scene is an > infinitesimal part. Of what dimension is it? My first guess > would be that it is five-dimensional, since every twist is four- > dimensional. But I'm not at all sure that my guess is right. > In fact, the spiral might be of a fractional dimension. The Riemann surface? Any fractal dimension you choose to name -> dimensio= n 2 (it's smooth). The smallest Euclidean embedding manifold that doesn't= force unnatural self-intersections: 3-dimensional. The graph itself? From C to the Riemann surface, straightforward multival= ued projection up and down onto the surface, so the surface *is* the grap= h.

Get Your Private, Free E-mail from MSN Hotmail at <= a href=3D"http://www.hotmail.com">http://www.hotmail.com.

------=_NextPart_001_0002_01C0DD61.B79C1680 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> As I watc= hed the image slowly take shape, I wondered about the
> infinite lo= garithmic spiral, of which today's scene is an
> infinitesimal part= .  Of what dimension is it?  My first guess
> would be th= at it is five-dimensional, since every twist is four-
> dimensional= .  But I'm not at all sure that my guess is right.
> In fact, = the spiral might be of a fractional dimension.
The Riemann= surface? Any fractal dimension you choose to name -> dimension 2= (it's smooth). The smallest Euclidean embedding manifold that doesn't fo= rce unnatural self-intersections: 3-dimensional.
The graph its= elf? From C to the Riemann surface, straightforward multivalued projectio= n up and down onto the surface, so the surface *is* the graph.



Get Your Private, Free E-mail from = MSN Hotmail at http://www.hotmail.com<= /a>.

------=_NextPart_001_0002_01C0DD61.B79C1680-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 08-05-01 (A Riot of Color [6]) Date: 15 May 2001 17:41:08 -0400 ------=_NextPart_001_0003_01C0DD66.39CB4780 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Classic FOTD -- May 08, 2001 (Rating 6) ^ You misspelled '8'. Keep up the good work! :-)

Get Your Private, Free E-ma= il from MSN Hotmail at
http://www.hotm= ail.com.

------=_NextPart_001_0003_01C0DD66.39CB4780 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Classic FO= TD -- May 08, 2001 (Rating 6)
      &nbs= p;            = ;            =             &= nbsp;         ^
Y= ou misspelled '8'.
 
Keep up the good work! :-= )



Get Your Private, Free = E-mail from MSN Hotmail at http://www.= hotmail.com.

------=_NextPart_001_0003_01C0DD66.39CB4780-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "David Jones" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 19 May 2001 16:12:12 -1000 --Message-Boundary-574 Content-type: text/plain; charset=US-ASCII Content-transfer-encoding: 7BIT Content-description: Mail message body Looks like more duplicates of old messages, Bogeys, my fractal friend ... You might try using http://www.mailandnews.com for a freemail account, might get rid of the problem. David gnome@hawaii.rr.com --Message-Boundary-574 Content-type: Message/RFC822 Received: from lamx01.mgw.rr.com ([24.30.163.16]) by hawaii.rr.com with Microsoft SMTPSVC(5.5.1877.517.51); Sat, 19 May 2001 15:51:29 -1000 Received: from lists.xmission.com (lists.xmission.com [198.60.22.7]) by lamx01.mgw.rr.com (8.11.1/8.11.1) with ESMTP id f4K1pO717810 for ; Sat, 19 May 2001 18:51:24 -0700 (PDT) Received: from domo by lists.xmission.com with local (Exim 2.12 #2) id 151ILz-00007q-00 for fractint-gooutt@lists.xmission.com; Sat, 19 May 2001 19:49:55 -0600 X-Originating-IP: [207.176.153.102] MIME-Version: 1.0 X-Mailer: MSN Explorer 6.00.0010.0912 Content-Type: multipart/alternative; boundary="----=_NextPart_001_0002_01C0DD61.B79C1680" Message-ID: X-OriginalArrivalTime: 15 May 2001 21:39:09.0562 (UTC) FILETIME=[79877DA0:01C0DD87] Sender: owner-fractint@lists.xmission.com Precedence: bulk Reply-To: fractint@lists.xmission.com Return-Path: owner-fractint@lists.xmission.com X-PMFLAGS: 570950016 0 ------=_NextPart_001_0002_01C0DD61.B79C1680 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > As I watched the image slowly take shape, I wondered about the > infinite logarithmic spiral, of which today's scene is an > infinitesimal part. Of what dimension is it? My first guess > would be that it is five-dimensional, since every twist is four- > dimensional. But I'm not at all sure that my guess is right. > In fact, the spiral might be of a fractional dimension. The Riemann surface? Any fractal dimension you choose to name -> dimensio= n 2 (it's smooth). The smallest Euclidean embedding manifold that doesn't= force unnatural self-intersections: 3-dimensional. The graph itself? From C to the Riemann surface, straightforward multival= ued projection up and down onto the surface, so the surface *is* the grap= h.

Get Your Private, Free E-mail from MSN Hotmail at <= a href=3D"http://www.hotmail.com">http://www.hotmail.com.

------=_NextPart_001_0002_01C0DD61.B79C1680 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> As I watc= hed the image slowly take shape, I wondered about the
> infinite lo= garithmic spiral, of which today's scene is an
> infinitesimal part= .  Of what dimension is it?  My first guess
> would be th= at it is five-dimensional, since every twist is four-
> dimensional= .  But I'm not at all sure that my guess is right.
> In fact, = the spiral might be of a fractional dimension.
The Riemann= surface? Any fractal dimension you choose to name -> dimension 2= (it's smooth). The smallest Euclidean embedding manifold that doesn't fo= rce unnatural self-intersections: 3-dimensional.
The graph its= elf? From C to the Riemann surface, straightforward multivalued projectio= n up and down onto the surface, so the surface *is* the graph.



Get Your Private, Free E-mail from = MSN Hotmail at http://www.hotmail.com<= /a>.

------=_NextPart_001_0002_01C0DD61.B79C1680-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" --Message-Boundary-574 Content-type: Message/RFC822 Received: from lamx01.mgw.rr.com ([24.30.163.16]) by hawaii.rr.com with Microsoft SMTPSVC(5.5.1877.517.51); Sat, 19 May 2001 15:53:16 -1000 Received: from lists.xmission.com (lists.xmission.com [198.60.22.7]) by lamx01.mgw.rr.com (8.11.1/8.11.1) with ESMTP id f4K1s6721657 for ; Sat, 19 May 2001 18:54:06 -0700 (PDT) Received: from domo by lists.xmission.com with local (Exim 2.12 #2) id 151IPc-0000vg-00 for fractint-gooutt@lists.xmission.com; Sat, 19 May 2001 19:53:40 -0600 X-Originating-IP: [207.176.153.102] MIME-Version: 1.0 X-Mailer: MSN Explorer 6.00.0010.0912 Content-Type: multipart/alternative; boundary="----=_NextPart_001_0003_01C0DD66.39CB4780" Message-ID: X-OriginalArrivalTime: 15 May 2001 21:39:12.0507 (UTC) FILETIME=[7B48DCB0:01C0DD87] Sender: owner-fractint@lists.xmission.com Precedence: bulk Reply-To: fractint@lists.xmission.com Return-Path: owner-fractint@lists.xmission.com X-PMFLAGS: 570950016 0 ------=_NextPart_001_0003_01C0DD66.39CB4780 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Classic FOTD -- May 08, 2001 (Rating 6) ^ You misspelled '8'. Keep up the good work! :-)

Get Your Private, Free E-ma= il from MSN Hotmail at
http://www.hotm= ail.com.

------=_NextPart_001_0003_01C0DD66.39CB4780 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Classic FO= TD -- May 08, 2001 (Rating 6)
      &nbs= p;            = ;            =             &= nbsp;         ^
Y= ou misspelled '8'.
 
Keep up the good work! :-= )



Get Your Private, Free = E-mail from MSN Hotmail at http://www.= hotmail.com.

------=_NextPart_001_0003_01C0DD66.39CB4780-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" --Message-Boundary-574 Content-type: Message/RFC822 Received: from lamx01.mgw.rr.com ([24.30.163.16]) by hawaii.rr.com with Microsoft SMTPSVC(5.5.1877.517.51); Sat, 19 May 2001 15:51:27 -1000 Received: from lists.xmission.com (lists.xmission.com [198.60.22.7]) by lamx01.mgw.rr.com (8.11.1/8.11.1) with ESMTP id f4K1pN717765 for ; Sat, 19 May 2001 18:51:23 -0700 (PDT) Received: from domo by lists.xmission.com with local (Exim 2.12 #2) id 151IMj-0000HE-00 for fractint-gooutt@lists.xmission.com; Sat, 19 May 2001 19:50:41 -0600 X-Originating-IP: [207.176.153.102] MIME-Version: 1.0 X-Mailer: MSN Explorer 6.00.0010.0912 Content-Type: multipart/alternative; boundary="----=_NextPart_001_0001_01C0DD5C.48E571A0" Message-ID: X-OriginalArrivalTime: 15 May 2001 21:39:06.0124 (UTC) FILETIME=[777AE4C0:01C0DD87] Sender: owner-fractint@lists.xmission.com Precedence: bulk Reply-To: fractint@lists.xmission.com Return-Path: owner-fractint@lists.xmission.com X-PMFLAGS: 570950016 0 ------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Hey Multiple- =20 >Interesting comments re dark matter, physics @ >12Gly, etc. =20 >What's your academic background? Officially? 5 credits short of a bachelor's in computers and math. Unofficially? I know something about everything and a lot more than the a= verage B.S. in some subjects.

Get Your Private, Free E= -mail from MSN Hotmail at http://www.h= otmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Hey Multip= le-
 
>Interesting comments re dark matter= , physics @ >12Gly, etc.
 
>What's your= academic background?
 
Officially? 5 credits = short of a bachelor's in computers and math.
Unofficially? I k= now something about everything and a lot more than the average = B.S. in some subjects.


<= hr>Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" --Message-Boundary-574-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 20-05-01 (Wrap-Around Midget [6]) Date: 19 May 2001 23:00:46 -0400 (EDT) Classic FOTD -- May 20, 2001 (Rating 6) Fractal visionaries and enthusiasts: A midget wrapped in cellophane -- how neat. It's unlikely, but it's what we have as today's FOTD. Actually, the cellophane wrapping the midget is composed of a series of tightly twisted spiral arms. And beyond the wrapping lies countless similarly wrapped symmetrical double spirals, each with a midget centered between the spirals. The formula behind the image, Z^(2.07)+C, is the same one that produced yesterday's image, though instead of being in a Seahorse Valley-type neighborhood, today's scene is located in an East Valley-type neighborhood. I have named the image "Wrap-Around Midget". I gave it this name when I saw the tightly-wrapped spiral arms enclosing the midget. The image rates a slightly immodest 6 on my conserva- tive rating scale. With a render time of a little over 10 minutes, the parameter file tries one's patience. To avoid tried and tired patience, the finished GIF image will soon be available on the Web at: and at: The fractal weather today was rather cloudy, humid and warm, with light rain in the early morning and a high temperature of 79F (26C) in the afternoon. The fractal cats accepted these conditions, though they would have preferred less wet grass. And I'm about ready to settle down in my favorite chair and accept some Saturday evening junk on TV. Those battling robots in the robot-wars seem rather interesting. Followed by a junky old 50's sci-fi movie, it will bring the week to a satisfactory close. Until tomorrow, take care, but not so much care that life ceases to be fun. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Wrap-Around_Midget { ; time=0:10:19.45--SF5 on a p200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotBC1 function=floor passes=1 center-mag=+0.36761262201121110/-0.074158329437401\ 64/1.29234e+008/1/-137.5 params=2.07/0/0/0 float=y maxiter=2400 inside=0 logmap=279 periodicity=10 colors=000PG0dKUU00IYe00ID7JPEKaKKmRLyYLz`azcqzjez\ qVzxKzz9zyQzufzpvyrrvuosvlpxhmyfjzcgz`0`V0e_1jc3of\ 5sj7xm8zqCupEloIdmKWlOOkQGjT7hPGcLOZIWUEdPAlK7uG5z\ AAu9Gl8Kd8PW7UO6ZG6c75g05a93YJ2RU2Nc1Hm0Cw0Hs6LpCQ\ mHVjN_gRzWYr_gkcqdezZ`xTWvOTsIOrDKp7Gm2Cl5Io7Oq9Us\ C_uEewHkyJqzLvzKmuJflI_dITWHLOGEGG77QR9`kCkzEdm9YY\ 6QG1K00O32Q86UD9WID_NIaRLeWPg`TwskfweQy`9zV0zQ0zP1\ wP5sP8qPCmOGjOJfONdOKeLIeJHfHEfECfCAg98g77g6GfGNfP\ VdZacbibfqajh`u`YpTVkKRfDPcQO`aN_mLZyLYlUW_aWNjV9r\ V0yV0xQ0wN0wI0vE1uA2u63s23s06j37a89TDAKIDANE2RG0VE\ CdETmDhwDyz9xw7wo5vg2u_0sT7qVEzYKo_JJaI5cRG_`QYz`U\ zjRzhKZhEOh8Eh2Qe0ac0ZU5WqCUlJQpQOqYLkdKe_K_VKURKU\ NJUIJUEJU9JU6GUDDUK9UR7UZ5Ue1Ul0Us0Wz0Zy0`y0cx0ex0\ gx8jvKluWorgqqdsk`veYy`UzVQzQNzKJzGTzK`zPhzUmzVrzW\ wzYzzZuz`ozcjzddzf_zgUzjOzlJzmDzp8zqDzpIzpNzoRzoWz\ o`zmezmxzezzpyzruzuqzvlzx } frm:MandelbrotBC1 { ; by several Fractint users e=p1, a=imag(p2)+100 p=real(p2)+PI q=2*PI*fn1(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z| Subject: Re: (fractint) C-FOTD 06-05-01 (A Hazy Mandelbrot [4]) Date: 15 May 2001 17:08:51 -0400 ------=_NextPart_001_0002_01C0DD61.B79C1680 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable > As I watched the image slowly take shape, I wondered about the > infinite logarithmic spiral, of which today's scene is an > infinitesimal part. Of what dimension is it? My first guess > would be that it is five-dimensional, since every twist is four- > dimensional. But I'm not at all sure that my guess is right. > In fact, the spiral might be of a fractional dimension. The Riemann surface? Any fractal dimension you choose to name -> dimensio= n 2 (it's smooth). The smallest Euclidean embedding manifold that doesn't= force unnatural self-intersections: 3-dimensional. The graph itself? From C to the Riemann surface, straightforward multival= ued projection up and down onto the surface, so the surface *is* the grap= h.

Get Your Private, Free E-mail from MSN Hotmail at <= a href=3D"http://www.hotmail.com">http://www.hotmail.com
.

------=_NextPart_001_0002_01C0DD61.B79C1680 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
> As I watc= hed the image slowly take shape, I wondered about the
> infinite lo= garithmic spiral, of which today's scene is an
> infinitesimal part= .  Of what dimension is it?  My first guess
> would be th= at it is five-dimensional, since every twist is four-
> dimensional= .  But I'm not at all sure that my guess is right.
> In fact, = the spiral might be of a fractional dimension.
The Riemann= surface? Any fractal dimension you choose to name -> dimension 2= (it's smooth). The smallest Euclidean embedding manifold that doesn't fo= rce unnatural self-intersections: 3-dimensional.
The graph its= elf? From C to the Riemann surface, straightforward multivalued projectio= n up and down onto the surface, so the surface *is* the graph.



Get Your Private, Free E-mail from = MSN Hotmail at http://www.hotmail.com<= /a>.

------=_NextPart_001_0002_01C0DD61.B79C1680-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 15 May 2001 16:29:59 -0400 ------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Hey Multiple- =20 >Interesting comments re dark matter, physics @ >12Gly, etc. =20 >What's your academic background? Officially? 5 credits short of a bachelor's in computers and math. Unofficially? I know something about everything and a lot more than the a= verage B.S. in some subjects.

Get Your Private, Free E= -mail from MSN Hotmail at
http://www.h= otmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Hey Multip= le-
 
>Interesting comments re dark matter= , physics @ >12Gly, etc.
 
>What's your= academic background?
 
Officially? 5 credits = short of a bachelor's in computers and math.
Unofficially? I k= now something about everything and a lot more than the average = B.S. in some subjects.


<= hr>Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0001_01C0DD5C.48E571A0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: (fractint) And I thought *duplicates* were bad. Date: 15 May 2001 18:57:27 -0400 ------=_NextPart_001_0000_01C0DD70.E273F620 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable Woah. Looks like the listserver coughed up a hairball. One of my own post= ings has somehow been reproduced to *five copies*. Then again, I had some= weird Hotmail error trying to send that one, so it might be that Hotmail= b00gered up. Or some weird software laser between hotmail and the listse= rver. I hope it doesn't cause too much trouble or inconvenience...

Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0000_01C0DD70.E273F620 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable


Woah. = Looks like the listserver coughed up a hairball. One of my own postings h= as somehow been reproduced to *five copies*. Then again, I had some weird= Hotmail error trying to send that one, so it might be that Hotmail b00ge= red up. Or some weird software laser between hotmail and the listserver.<= /DIV>
 
I hope it doesn't cause too much trouble or = inconvenience...



Get Your= Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0000_01C0DD70.E273F620-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: Re: (fractint) C-FOTD 28-04-01 (Semi-Chaos [4]) Date: 20 May 2001 20:04:52 +1200 At 14:12 20/05/2001, you wrote: >Looks like more duplicates of old messages, Bogeys, my >fractal friend ... You might try using >http://www.mailandnews.com for a freemail account, might >get rid of the problem. > >David >gnome@hawaii.rr.com Ah well; would you expect any different behaviour from Microsoft? Morgan L. Owens "It's like shooting fish in a barrel - with a bazooka." Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Ricardo M. Forno" Subject: Re: (fractint) C-FOTD 08-05-01 (A Riot of Color [6]) Date: 20 May 2001 12:27:02 -0300 This is a multi-part message in MIME format. ------=_NextPart_000_0029_01C0E128.2C2900C0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable Hey, Multiple! Duplicate messages don't stop coming. Is it your problem = or fractint's server? ----- Original Message -----=20 From: Multiple Bogeys=20 To: fractint@lists.xmission.com=20 Sent: Tuesday, May 15, 2001 6:41 PM Subject: Re: (fractint) C-FOTD 08-05-01 (A Riot of Color [6]) >Classic FOTD -- May 08, 2001 (Rating 6) ^ You misspelled '8'. Keep up the good work! :-) ----- Get Your Private, Free E-mail from MSN Hotmail at = http://www.hotmail.com. ------=_NextPart_000_0029_01C0E128.2C2900C0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
Hey, Multiple! Duplicate messages don't stop = coming. Is it=20 your problem or fractint's server?
----- Original Message -----
From:=20 Multiple=20 Bogeys
Sent: Tuesday, May 15, 2001 = 6:41 PM
Subject: Re: (fractint) C-FOTD = 08-05-01=20 (A Riot of Color [6])

>Classic FOTD -- May 08, 2001 (Rating=20 = 6)
           &= nbsp;           &n= bsp;           &nb= sp;           &nbs= p;     ^
You misspelled '8'.
 
Keep up the good work! :-)
------=_NextPart_000_0029_01C0E128.2C2900C0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: bmc1@airmail.net Subject: (fractint) Re: Multiple messages Date: 20 May 2001 12:31:22 -0500 Just FYI, I, too, continue to receive as many as 6 copies (never fewer than 2) of almost all posts, Multiple's (naturally), being the most multiple. However, the fact that I receieve dup's of all of any Posts which are multiple indicates a problem  w/ my local ISP.

I've eliminated the most frequently-occurring Netscape source of "multiples"  -  common in Communicator versions 4.5+ according to my ISP and Netscape itself - in which specifying a "Preference" for having a copy of all incomings from a given Sender or Subject saved in a separate Folder for Archival reasons, frequently leads to its being downloaded twice, or downloaded once and internally-rewritten from cache back to Netscape's list of "New Messages".

I also have received Multiple's multiples in waves: the same message 2, or 4 at a time, separated by several minutes under "date", suggesting that there may be some problem with (dare I suggest it) Multiple's ISP, or- more threatening yet - with Multiple's own [computer] equipment*. :-)

What these symptoms might suggest to someone more computer literate than myself (i.e., anyone else on this site) would be interesting to hear, as it is an intermittent  but recurrent problem for me, and RMF brought it up.

Specifically, I wonder if PNL has a comment or any of these same problems w/ multiple copies of the same post (their arriving simultaneously and sometimes in a second or third round), as I believe we share at least one ISP?.

DFreed
 

*-    "Just a thought. I could be wrong" - Bill Mahr
 

"Ricardo M. Forno" wrote:

Hey, Multiple! Duplicate messages don't stop coming. Is it your problem or fractint's server?
----- Original Message -----
Sent: Tuesday, May 15, 2001 6:41 PM
Subject: Re: (fractint) C-FOTD 08-05-01 (A Riot of Color [6])
 >Classic FOTD -- May 08, 2001 (Rating 6)
                                                     ^You misspelled '8'. Keep up the good work! :-) 


Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.
Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul N. Lee" Subject: Re: (fractint) C-FOTD 08-05-01 (A Riot of Color [6]) Date: 20 May 2001 12:57:11 -0500 Ricardo M. Forno wrote: > > Hey, Multiple! Duplicate messages don't > stop coming. Is it your problem or > fractint's server? > This seems to have started on Tuesday (May 15, 2001). And since that time, I have not been receiving quantities of duplicates from any of the other posters to this List except from one individual. Which leads me to believe that it is not a problem with the Majordomo mail server used for the FractInt Discussion List. Maybe it has something to do with the MSN Explorer 6.00.0010.0912 which "Multiple Bogeys" uses (after all, it is another Microsoft product going through a Hotmail account). Sincerely, P.N.L. http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 21-05-01 (The Fractal Blob [7]) Date: 21 May 2001 11:03:08 -0400 (EDT) Classic FOTD -- May 21, 2001 (Rating 7) Fractal visionaries and enthusiasts: I enjoy junky old sci-fi movies, and to a lesser extent their close relatives, junky old horror movies. (They're not good enough to be called films.) One of my favorites is the original version of "The Blob". Yes, I know there have been more recent blob movies with better special effects, but the cheesy effects are one of the things that makes junky old movies so much fun to watch, especially after a day when a job goes sour and the customer complains. (It's nice to know that I'm not the only one who occasionally goofs up.) The more recent thrillers with their computerized effects are far better done and far more convincing to watch, but with a few exceptions they have become predictable, and more importantly, they just don't produce the same satisfaction of seeing that I'm not alone in my bloopers. Despite its lateness, today's image, which rates a 7, is not a blooper. The parent fractal, which was drawn by the formula Z^(sqrt(5))+C, is a double-lobed thing with a split along the entire length of the X-axis, and prominent buds on both sides of the split. The midget in the image is located in a tight spiral in a cutoff area of chaos in the center of the west branch of the valley of the southern bud. I named the image "The Fractal Blob" in honor of that 50-year- old movie, a film that probably deserves no honor. Running the parameter file will set one back 1/2 hour, making a download of the image file the better way of viewing the scene. In an hour or so, that download will be available on the internet at: and at: The fractal weather today was cloudy with occasional light rain, which became heavier and steadier as the day progressed. The rain, along with the temperature of 60F (15.5C), made the fractal cats testy. As for me, I'm not testy, but I am busy. So it's time to end the FOTD for today and start preparing for the next FOTD. Until then, take care, and fractals are still politically correct. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ The_Fractal_Blob { ; time=0:28:52.22--SF5 on a p200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotBC1 function=floor passes=1 center-mag=-0.64630333319106740/-0.393163495225974\ 80/7814360/1/125 params=2.236068/0/0/0 float=y maxiter=4500 inside=0 logmap=-755 periodicity=10 colors=00037F37H37J37M37O37R37U37X39Z3Aa3Bc3DH3EH3\ FM4HM2FN0EN0BN0AO09O07M07O09R0AU0AX0BZ0Da0Dc0Ef0Fi\ 0Fk0Hn0Iq0Is0Kv0Ly0Oz0Lz0Kw0Iu0Hr0Eo0Dm0Bj0Eg0Ie0M\ f0Qg0Ui0Yj0ak0em2in3mo4pq6rr7us8uu4uuAuuSwzFzz0zz3\ zzBzzJzzPwzZuzftzmmzkfzkazkayk`wk`ukZskYqkYokXmkXk\ kVikUgkUekTckTakR_kQYkQXkPUkPSkOQkMOkMMkLKkLIkKHkI\ EkIDkHAkH8kF6iE4gE2eD0cD0aB0`A0cB0eB0iB0kD0mD0nD0n\ E2oE3oE3oF4qF6qF7qH7rH8rHAsIBsIBsIDuKEuKFuKFvLHvLI\ wLJwMKwMKyMMyONzOOzOOzPQzPRzPSzQSzQUzQVzRXzRXzRYzT\ ZzT_zRbzT_zTZzTYzTXwUVvUSuURrUQqUOnVNmVMjVNiVOgVQe\ XRcXSaXU_XVYYXXYYVYZSY_RYaOZbNZcKZeJZfH`gI`iI`jI`k\ I`mI`nI`oI`qI`rI`sJ`uJ`vJ`wJ`yJ`zJ`zJ`zJ`zJ`zK`zK`\ zK`zK`zK`zK`zK`zK`zK`zM`zM`zM`zM`zM`zM`zM`zM`zM`zN\ `zN`zN`zN`zN`zN`zN`zN`zN`zM`zN`zO`zQ`zR`zS`zU`zV`z\ X`zY`zZ`z_`za`zb`zc`ze`zf`zg`zi`zi`zj`zk`zm`zn`zn`\ zo`zq`zr`zs`zu`zv`zw`zy`z } frm:MandelbrotBC1 { ; by several Fractint users e=p1, a=imag(p2)+100 p=real(p2)+PI q=2*PI*fn1(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z| Subject: (fractint) Hi, little problem with first formulas... Date: 17 May 2001 17:41:23 +0200 Dear Friends: My name is Francisco Andeyro. I'm a student at the polytechnic of Madrid, and a fractal and mathematics enthusiast, like you all. I'm doing some research in Graphic cryptography, with some algorithms, similar to automatas. All technical info is avaible at: http://www.arkion.es But the problem i have, has nothing to do with that. I'm doing my first steps in managing formula fractals. As a first simple exercise i decided to write a formula file for representing a simple Mandelbrot: MandelPrueba {;Quicote z0=c=pixel z=z*z+c } And it draws something very similar to a mandel, but irregular and broken; and i got really surprised when i turn on Floating Point... and i obtained an empty blue screen... I've run also MandelPrueba {;Quicote z0=c=pixel z=z*z+c |z|<4 } With similar result. I'm sure that it has an obvious explanation, ...but i'm young and unexperinced... Please help me I'm using Fractint 20.0. Thanks in advance. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 22-05-01 (Shadows [6]) Date: 22 May 2001 10:20:08 -0400 (EDT) Classic FOTD -- May 22, 2001 (Rating 6) Fractal visionaries and enthusiasts: I appear to be running out of names for my (IMO) wonderful, classic fractals. Today's image, for example, is filled with holes -- puddles, ponds, lakes, bays, harbors, straits, seas and one ocean -- the interior of the midget. All this water and no name. What to name such an image? While searching for a name, I began wondering about those extra holes in the image. In today's image they resemble the shadows of butterflies. Such holes have no right to be there, but they almost always appear in fractals that combine different powers of Z. Thinking about the supernumerary holes, I named today's image "Shadows", and rated it a 6. It's a half-hour render, so don't hesitate to give Paul and Lee a chance to render and post the image, and then download the GIF file from the web site of one of them. Paul's site is found at" and Scott's at: The fractal weather today was rainy. Combined with the temperature of 59F (15C), it was too unpleasant for the cats, who sulked indoors. But it was fine for me, giving me no excuse for slacking on the real work. I actually got pretty much caught up, which might give me a chance to get into the philosophy that has been so absent for several months. Until next FOTD, take care, and search for truth. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Shadows { ; time=0:32:13.22--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=-257.25336905442320000/-240.09578313226\ 730000/17019.59/1/10 params=1/1/1/3/0/0 float=y maxiter=5000 inside=0 periodicity=10 colors=000xzCvzBqz9nz8jz6gz5cz3`w2Yv1Tt0Rq0Mp0Jn0F\ m0Cj08h05g02f08a0CZ0HX0LT0PR0TO0YL0cI0gF0kC0p90t60\ x30z10z00x20q60hB1aF3VJ5MO6FS96XB0`C0cE1XI8RMFJRME\ VT6Z`1cg0fd0cc0``0YZ0VX0SV0PS0MR0JO0HM0EL0CJ0CJ1CI\ 5BI8BHIBFK9FN9EQ9ES9BRB9PB6OC3LE1JF0IH0HH1LI5OI8RI\ CTIHYIJ`IOcISfIVhIZkIcnIfqIjtImvIjwLhvMftOdsPaqS`p\ TZnVXmXVkZSj`RhaPgc9FP00C309C08L25V63cC1kH0vL0zS0x\ R0vQ0tP0rO0pN0mM0iL0pS0mS0hS0fS0cS0`S0XS0TS0RS0OS0\ PV0PX0PY0RZ0R`0Rc0Sd0Sf0Sg0Th0Tk0Tm0Vn0Vp0Vq0Mv0Fz\ 08z06z05w65tH3pR2m`2jj1ft0cz0`zETzSMzfFzt8wz2tz5qz\ 6nx9kwBhtEfqFcpH`mJYjLVgOSfPPcSM`TJZVHYYJY`LYcMYdO\ XgPXjRXkSXnTVqVVsXVvYVxZTz`TzaTzcTzdIwn8nwEjsJfpOc\ mTZjZXgcSdhOanLZsHXxETz9Rz6Oz8Ms9Lj9LcBJVBJOCIFEH8\ EH0FF0FF0LM1PS3TY8YcCahFfnJjtMnzPpwSqvVstYts`vpcwn\ fxmhzkkzhnzgqzftzdwzazz`zzZzzYzzVzzSzxRxvOwsLvnJtk\ HshEqfCpc9n`6mY3kV1jS1hP1 } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: George Martin Subject: (fractint) Message from Internet Date: 22 May 2001 10:37:03 -0400 Fractint friends, I am forwarding the following message to me, in hopes that someone will have an answer to the question posed. George -------- Forwarded Message -------- = TO: ggmartin = = Dear George, I'm an Italian boy and i'm attending the last year of enviromental = enginnering at Politecnico of Milano. I'm working on my degree thesis and i need to generate 3D BROWNIAN MOTION= = SURFACES based on HURST's exponent like the fractional brownian islands.= = I'd want to know if is it possible doing that whith FRACTINT. THANK YOU VARY MUCH, Ciao, Paolo ----------------------- Internet Header -------------------------------- Sender: colombus@inwind.it Received: from relay4.inwind.it (relay4.inwind.it [212.141.53.75]) by siaag1aa.compuserve.com (8.9.3/8.9.3/SUN-1.9) with ESMTP id HAA24908 for ; Tue, 22 May 2001 07:27:59 -0400 (EDT) Received: from server7.inwind.it (62.98.5.250) by relay4.inwind.it (5.5.0= 29) id 3AF9945F003F0608 for ggmartin@compuserve.com; Tue, 22 May 2001= 13:27:58 +0200 Message-Id: <5.0.0.25.0.19940414132404.009e40f0@popmail.inwind.it> X-Sender: colombus@popmail.inwind.it X-Mailer: QUALCOMM Windows Eudora Version 5.0 Mime-Version: 1.0 Content-Type: text/plain; charset=3D"us-ascii"; format=3Dflowed = Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul N. Lee" Subject: Re: (fractint) Message from Internet Date: 22 May 2001 13:29:23 -0500 George Martin wrote: > > I am forwarding the following message to me, > in hopes that someone will have an answer to > the question posed. > I am not sure about doing so in FractInt, but concerning his main topic, there would be many that could assist within the Usenet Newsgroup: news:sci.fractals Sincerely, P.N.L. http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) Re: C-FOTD 22-04-01 Date: 15 May 2001 10:50:11 -0400 ------=_NextPart_001_0006_01C0DD2C.D2434F60 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Rambling story, flying heads, men in diapers, topless women -- it has ev= erything. Topless women? In the Wizard of Oz?! Someone is spinning in his/her grave= . Decent old sci-fi movies I've seen: The Fly and friends (the three old ones, not the 80s remakes -- those are= good too but not *old*!) 2001 (a bit slow in places) A Crack in the World (cheesy, I know) Forbin: The Colossus Project (parts of it suck, but the rest...) Star Wars: ANH(!) The Terminal Man The Andromeda Strain Decent 80s: Tron 2010 Anything Short Circuit Star Wars: ESB, ROJ Star Trek: TMP (a bit slow in places) Star Trek 2, 4, 6(? -- might have been early 90s) Starman, Last Starfighter, assorted other Starfoo Moonraker (hey, it had a freaking big [and unrealistic] space station!) Assorted Superman movies and spinoffs (why the *hell* did they stop makin= g these?) The Fly (1985 remake) and probably its sequel (which I've never managed t= o see) Back to the Freaking Future! (and sequels -- let's see if these b*stards = can do 90!) Cocoon and sequels, *Batteries Not Included (oh, crap, I'm turning into a= sap!) John Carpenter's Village of the Damned (or was that late 70s?) Original shrunk the kids (the sequels sucked, and the TV show blows) Decent modern ones: Phantom Menace (duh) Mission to Mars (ymmv) Stargate (obscure; the TV show rocks too and is still in production), ID4 Armageddon, Deep Impact (so the science in Armageddon sucked. It was stil= l fun.) Jurassic Park (but the sequel sucked) Goldeneye (hey, it had funky nuclear weapons!) X-Men Lost In Space Any recent Star Trek movie (with Picard and crew!) -- especially the ones= with the azz-kicking Enterprise E. Especially the last one. Any film that depicts an older woman as desirabl= e gets bonus points. Special edition Star Wars ROJ and ANH! Aliens (nice explosion near the end -- too bad the sequel sucked. The pre= quel is too old for this list.) The Abyss (often overlooked, *cool* music) Sphere (It *did* come from the Creighton-meister) Event Horizon (Not for the faint of heart -- if you use nitroglycerine fo= r something other than blowing things up, I recommend Aliens instead. J/k...) Starship Troopers (WARNING: Take one (1) Pepto-Bismol before viewing. Avo= id viewing in an aircraft, motor vehicle, elevator, ship*, or other moving vehicle, or dur= ing an earthquake. Avoid viewing while on a waterbed. =20 Keep a pail handy, preferably one that is easy t= o wash. *Spacecraft are an exception, except during an e= ngine burn.) Recent ones I haven't seen, but that look good: Supernova Red Planet (not to confuse with Mission to Mars) Alien 4 Titan: AE(!) DVD special edition version of ST:TMP (obscure) Less sure about: Deep Blue Sea Battlefield: Earth Up-and-coming and guaranteed good: Star Wars II (duh) Star Trek X (duh) Star Wars III (don't hold your breath) Rumored: A Matrix sequel or prequel (*drool*) DVD Recommended due to digital FX and widescreen: Star Trek 9 (duh) Phantom Menace (duh! don't have it but it *has* to rock!) The Matrix (check out the whole last third -- also loads of extras on the= disk) Armageddon (if you hate the Eiffel Tower you'll love the DVD version of t= his) Deep Impact (probably; don't have it) Star Wars: ANH, ROJ -- the explosion of the ROJ Death Star really suffers= on pan-and-scan, although the pan-and-scan version of the sail barge explosion scen= e is more impressive because of the dramatic panning! ID4 (duh! the small screen really wrecks the impressive alien ship arriva= l scene! then there's the massive fights, explosions, &c) Stargate (probably; don't have it) Supernova and Titan: AE (probably; don't have either on DVD or VHS) Stuff that sucked: The Food of the Gods The Day of the Triffids (a crying shame; the book rocks) Any of several bad Frankenstein rip-offs from the 60s, 70s, and 80s Any of several bad Dracula rip-offs from the 60s, 70s, and 80s* Asteroid! (this one made Armageddon look scientifically accurate!) * RHPS excluded, special exemption OK: Screamers Downdraft Star Trek 3, 5 Space Cowboys The Arrival The Arrival II (probably -- got a DVD of it, but haven't gotten around to= viewing it yet) Good spoofs: Spaceballs! Galaxy Quest The Zero Wing flash animation(!)* The movie was good but the book sucked: * Several of the Star Trek movies * Someone set up us the Zerowing reference!

Get Your P= rivate, Free E-mail from MSN Hotmail at
http://www.hotmail.com.

------=_NextPart_001_0006_01C0DD2C.D2434F60 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Rambling s= tory, flying heads, men in diapers, topless women -- it has everything.
 
Topless women? In the Wizard of Oz?! Someone = is spinning in his/her grave.
 
Decent old sci= -fi movies I've seen:
The Fly and friends (the three old ones,= not the 80s remakes -- those are good too but not *old*!)
200= 1 (a bit slow in places)
A Crack in the World (cheesy, I know)=
Forbin: The Colossus Project (parts of it suck, but the rest.= ..)
Star Wars: ANH(!)
The Terminal Man
T= he Andromeda Strain
Decent 80s:
Tron
2010
Anything Short Circuit
Star Wars: ESB, ROJ
=
Star Trek: TMP (a bit slow in places)
Star Trek 2, 4, 6(?= -- might have been early 90s)
Starman, Last Starfighter, asso= rted other Starfoo
Moonraker (hey, it had a freaking big [and = unrealistic] space station!)
Assorted Superman movies and spin= offs (why the *hell* did they stop making these?)
The Fly (198= 5 remake) and probably its sequel (which I've never managed to see)
=
Back to the Freaking Future! (and sequels -- let's see if these b*s= tards can do 90!)
Cocoon and sequels, *Batteries Not Included = (oh, crap, I'm turning into a sap!)
John Carpenter's Village o= f the Damned (or was that late 70s?)
Original shrunk the kids = (the sequels sucked, and the TV show blows)
Decent modern= ones:
Phantom Menace (duh)
Mission to Mars (ymmv)<= /DIV>
Stargate (obscure; the TV show rocks too and is still in produ= ction), ID4
Armageddon, Deep Impact (so the science in Armaged= don sucked. It was still fun.)
Jurassic Park (but the sequel s= ucked)
Goldeneye (hey, it had funky nuclear weapons!)
X-Men
Lost In Space
Any recent Star Trek movie (= with Picard and crew!) -- especially the ones with the azz-kicking Enterp= rise E.
Especially the last one. Any film that depicts an olde= r woman as desirable gets bonus points.
Special edition Star W= ars ROJ and ANH!
Aliens (nice explosion near the end -- too ba= d the sequel sucked. The prequel is too old for this list.)
Th= e Abyss (often overlooked, *cool* music)
Sphere (It *did* come= from the Creighton-meister)
Event Horizon (Not for the faint = of heart -- if you use nitroglycerine for something other than blowing th= ings up,
         = ;           I recommend= Aliens instead. J/k...)
Starship Troopers (WARNING: Take one = (1) Pepto-Bismol before viewing. Avoid viewing in an aircraft, motor vehi= cle,
         &nb= sp;           &nbs= p;   elevator, ship*, or other moving vehicle, or during an ear= thquake. Avoid viewing while on a waterbed.
   = ;            =           Keep a pail handy,= preferably one that is easy to wash.
    =             &= nbsp;        *Spacecraft are an e= xception, except during an engine burn.)
Recent ones I haven't= seen, but that look good:
Supernova
Red Planet (no= t to confuse with Mission to Mars)
Alien 4
Titan: A= E(!)
DVD special edition version of ST:TMP (obscure)
Less sure about:
Deep Blue Sea
Battlefield: Earth=
Up-and-coming and guaranteed good:
Star Wars II (d= uh)
Star Trek X (duh)
Star Wars III (don't hol= d your breath)
Rumored:
A Matrix sequel or prequel = (*drool*)
 
DVD Recommended due to digital FX = and widescreen:
Star Trek 9 (duh)
Phantom Menace (d= uh! don't have it but it *has* to rock!)
The Matrix (check out= the whole last third -- also loads of extras on the disk)
Arm= ageddon (if you hate the Eiffel Tower you'll love the DVD version of this= )
Deep Impact (probably; don't have it)
Star Wars: = ANH, ROJ -- the explosion of the ROJ Death Star really suffers on pan-and= -scan, although the pan-and-scan
     = ;            =             &= nbsp;   version of the sail barge explosion scene is more impre= ssive because of the dramatic panning!
ID4 (duh! the smal= l screen really wrecks the impressive alien ship arrival scene! then ther= e's the massive fights, explosions,
     &= amp;c)
Stargate (probably; don't have it)
Supernova= and Titan: AE (probably; don't have either on DVD or VHS)
&nb= sp;
 
Stuff that sucked:
The Food o= f the Gods
The Day of the Triffids (a crying shame; the book r= ocks)
Any of several bad Frankenstein rip-offs from the 60s, 7= 0s, and 80s
Any of several bad Dracula rip-offs from the= 60s, 70s, and 80s*
Asteroid! (this one made Armageddon look s= cientifically accurate!)
 
* RHPS excluded, sp= ecial exemption
 
OK:
Screame= rs
Downdraft
Star Trek 3, 5
Space Cowboy= s
The Arrival
The Arrival II (probably -- got a DVD= of it, but haven't gotten around to viewing it yet)
 
Good spoofs:
Spaceballs!
Galaxy Quest
The Zero Wing flash animation(!)*
 
The= movie was good but the book sucked:
* Several of the Star Tre= k movies
 
 
 
* Someone set up us the Zerowing reference!

=

Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

------=_NextPart_001_0006_01C0DD2C.D2434F60-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jim Muth Subject: (fractint) C-FOTD 23-05-01 (Simply Wonderful [9]) Date: 22 May 2001 23:50:28 -0400 (EDT) Classic FOTD -- May 23, 2001 (Rating 9) Fractal visionaries and enthusiasts: I am quite pleased with today's image, so pleased in fact that I rated it a lofty 9, which equals 'one of the best' on my scale of fractal worth. I named the image "Simply Wonderful" as a statement of my opinion of it. Actually, the image came as a lucky mistake. When I brought up the MandelbrotBC1 formula, I forgot to shift the function from the 'recip' that I had been using with the M-Mix4 formula. I had intended on using the 'floor' function and didn't realize my oversight until well into exploration of the parent fractal. But my mistake turned out to be serendipitous when I found a very interesting area to investigate. The result almost but not quite speaks for itself. I don't know why today's image pleases me so. Perhaps it's the colors, but probably not, for I spent only 15 minutes working with the colors. Perhaps it's the shapes, but I have seen such shapes countless times before. Perhaps it's the mood I'm in, but my mood is also average. I suppose it's one of those things that we'll never know, but regardless, the picture is pleasing to look at, and well worth a look. The expression Z^1.861209718+C was iterated to create the fractal. The exponent is the fourth root of 12, though I doubt that this has any effect on the finished image. The wonderful image may be seen by running the parameter file and waiting 12 minutes or by giving Paul and Scott a chance to render and post the GIF file of the image to their web sites at: and at: and downloading it from there. The fractal weather today was partly cloudy with a temperature of 79F (26C). The afternoon and evening were spoiled however by a series of heavy thunder-storms, which deluged the area and frightened the fractal cats under the bed. I'll return in roughly 24 hours with a fractal and the start of the philosophy I've been accumulating over the past several months. I've got a break, and the time at last has come to kick start the sleeping philofractal list with some controversial words of wisdom. Until tomorrow, take care, and enjoy today's fractal -- it could be a long time before a better one appears. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Simply_Wonderful { ; time=0:12:04.56--SF5 on a p200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotBC1 function=recip passes=1 center-mag=-0.597094120794136/+0.7542511965684781/\ 1.392532e+009/1/-122.5 params=1.861209718/0/5.5/0 float=y maxiter=2800 inside=0 logmap=317 periodicity=10 colors=000_2Z_2_b2`e2`h2ak2an2aq2`t3aw2avAavFbvHdt\ LdtPesSfsXfsZhrbirfipikpmlpplotmoyomzomzpmzpozmpzk\ pzirzfszdszbty`twZvvXwtUwsSyrPzpNzoLzmJzlHzkFziCzh\ Azf7zm5zk3zb1zb0za2r`3i`6aZ7UYALYCDXF5VG0VH0SG0RF0\ PD0OC0LA1K91J71H62F5GD3zC2tA1r70m60k50f30d10a00Z00\ X00U00S00R00P00O01N02L05K06J09H0AH0CJ1FK1GL1JL1KN1\ NO2OP2RP2SR2VS2XS2YU1ZU1ZU1`U1`U1aU1aU1bU1bU1dU1dV\ 1eV1eV1fV1fV1hV1hV1iV1iV1kV1kV1kS5fP9bNCZLGXJJSGNO\ DPLCUH9YD6`A3d62f20k00m00r00t00s01r05p07p0Co0Gm0Jm\ 0Nl0Rk0Uk0Yi0ae0ea0hY0fU0fU0fU0fU0fU0fU0fRGfRNfQUf\ LafOafObfPbeRdbedaheZkeYmfVpfUrhSthPwiOztLzzKzzJzz\ OytUrhZkfbdehYdmUbsUawU`mUfdUmVUtLUzDUzGUtHUhJaXKf\ KLf7Nf0Ok0Oo1Ol3Os5Ps7Pt9PtCPtDRzGRzHRzKRzLSzOSzPS\ zSSzUUzXUzYUz`UzaVzbVzdXzdXzeYzfYzfZzhZziZzi`zk`zl\ azlazmbzobzobzpdzrdzrezseztfztfzvfzvhzsizpkzmlzkmz\ iozfpzdrzaszZtzYvzVwzSFzP } frm:MandelbrotBC1 { ; by several Fractint users e=p1, a=imag(p2)+100 p=real(p2)+PI q=2*PI*fn1(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z| Subject: (fractint) A little help with Fractint project needed Date: 23 May 2001 09:52:10 +0200 Hi hope I can get some help on this one. I'm having a problem that I hope You can help me with. I'm experimenting with a autozoom application for Fractint. I load a Fractint image on the screen and search until I find the rectangle I want to zoom into, (there is no rotation, or skewing on this rectangle). I know the heigth and width of the source image in pixels, and the center-mag parameters for the the fractal image on the screen. I also know the position,heigth and with in pixels of the area that i want to zoom into. What I can't figure out, is how to calculate the Center-mag parameters for the fractal that's inside the area (rectangle) that I want zoom into. I get it rigth if there is rotation = 0 and skewing = 0 in the start fractal, but I can't figure out how I'm going to to this calculation if the rotation or/and skewing is different from 0. I would be very glad if You could help me, or tell me where I can find the answer that I need. I have tried to find it in the Fractint source, but with no luck. Thore Berntsen Norway Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Chris Curnow" Subject: Re: (fractint) A little help with Fractint project needed Date: 23 May 2001 21:19:38 +0100 This is a multi-part message in MIME format. ------=_NextPart_000_0023_01C0E3CE.12BE3F80 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Subject: (fractint) A little help with Fractint project needed >I load a Fractint image on the screen and search until I find the = rectangle I=20 >want to zoom into, (there is no rotation, or skewing on this = rectangle). I=20 >know the heigth and width of the source image in pixels, and the = center-mag=20 >parameters for the the fractal image on the screen. I also know the=20 >position,heigth and with in pixels of the area that i want to zoom = into. >What I can't figure out, is how to calculate the Center-mag parameters = for the=20 >fractal that's inside the area (rectangle) that I want zoom into.=20 I may be able to help here, Thore. I wrote a 'zooming' program in VB = which produces .par entries for a 'zoom out' of a given fractal. (Indeed it = uses your screen-saver program to generate the .gif images!) Once the images are = generated there is a companion program to animate the zoom-out - zoom-in. You are welcome to the source, it may help. Chris Curnow curnow@mail.telepac.pt ------=_NextPart_000_0023_01C0E3CE.12BE3F80 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Subject: (fractint) A little help with Fractint project=20 needed
 
>I load a Fractint image on the screen and search until I find = the=20 rectangle I
>want to zoom into, (there is no rotation, or skewing = on this=20 rectangle). I
>know the heigth and width of the source image in = pixels,=20 and the center-mag
>parameters for the the fractal image on the = screen. I=20 also know the
>position,heigth and with in pixels of the area = that i want=20 to zoom into.

>What I can't figure out, is how to calculate = the=20 Center-mag parameters for the
>fractal that's inside the area = (rectangle)=20 that I want zoom into. 
 
I may be able to help here, = Thore. =20 I wrote a 'zooming' program in VB which
produces .par entries for = a 'zoom=20 out' of a given fractal.  (Indeed it uses your
screen-saver program to = generate the .gif=20 images!)  Once the images are generated
there is a companion program = to animate=20 the zoom-out - zoom-in.
 
You are welcome to the = source, it may=20 help.
 
Chris Curnow
curnow@mail.telepac.pt<= /DIV>
 
------=_NextPart_000_0023_01C0E3CE.12BE3F80-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Lee Lane" Subject: (fractint) high speed generation Date: 23 May 2001 18:55:14 -0500 This is a multi-part message in MIME format. ------=_NextPart_000_0015_01C0E3B9.E698C380 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable I have recently tried Fractint on a PentiumIV 1.4GHz processor with = 128 Mbytes of SDRAM and Windows Millennium with 32MB NVIDIA graphics. To = my surprise, it was generated images only slightly faster than my PII = 300MHz with 48 MB of SGRAM and Windows 95 with ATI RAGE PRO graphics. It = ranged from about 1.4 to 1.9 times faster, never as much as twice as = fast, despite the huge jump in hardware capacity. Is there an intrinsic limit to the speed of Fractint? Or might there = be an inhibiting incompatibility with Windows ME such that I would get = more speed by loading Windows 95 (or 98)onto the computer? Or should I just take the darned thing back? Lee Lane ------=_NextPart_000_0015_01C0E3B9.E698C380 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
    I have recently tried = Fractint on=20 a PentiumIV 1.4GHz processor with 128 Mbytes of SDRAM and Windows = Millennium=20 with 32MB NVIDIA graphics. To my surprise, it was generated images only = slightly=20 faster than my PII 300MHz with 48 MB of SGRAM and Windows 95 with ATI = RAGE PRO=20 graphics. It ranged from about 1.4 to 1.9 times faster, never as much as = twice=20 as fast, despite the huge jump in hardware capacity.
    Is there an intrinsic = limit to=20 the speed of Fractint? Or might there be an inhibiting = incompatibility with=20 Windows ME such that I would get more speed by loading Windows 95 (or = 98)onto=20 the computer?
    Or should I just take = the darned=20 thing back?
 
    Lee=20 Lane
------=_NextPart_000_0015_01C0E3B9.E698C380-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jim Shaffer, Jr." Subject: Re: (fractint) high speed generation Date: 23 May 2001 21:35:46 -0400 > Is there an intrinsic limit to the speed of Fractint? Or might there be an inhibiting incompatibility with Windows > ME such that I would get more speed by loading Windows 95 (or 98)onto the computer? Strictly a guess here, but I've heard that ME is a new operating system with a DOS *emulator* rather than being built on top of DOS like the older versions of Windows. If that's the case, maybe Fractint calls some routine which is particularly poorly-implemented. Or maybe the ME DOS-emulation display drivers are poorly-implemented. -- Earth for Earthlings! Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: Re: (fractint) high speed generation Date: 24 May 2001 18:19:53 +1200 At 13:35 24/05/2001, Jim Schaffer wrote: > > Is there an intrinsic limit to the speed of Fractint? Or might there be an >inhibiting incompatibility with Windows > > ME such that I would get more speed by loading Windows 95 (or 98)onto the >computer? > >Strictly a guess here, but I've heard that ME is a new operating system with a >DOS *emulator* rather than being built on top of DOS like the older >versions of >Windows. If that's the case, maybe Fractint calls some routine which is >particularly poorly-implemented. Or maybe the ME DOS-emulation display >drivers >are poorly-implemented. That can't quite be it: Windows 95 itself is an operating system that has a DOS emulator, rather than being a graphical shell for DOS like Windows 3.x. But Microsoft wants everyone to forget DOS (and command-line interfaces in general) as a bad idea, and are probably actively brain-damaging the emulators to make it look even more unattractive. Morgan L. Owens "My other OS is a Linux" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "David Jones" Subject: Re: (fractint) high speed generation Date: 23 May 2001 21:35:15 -1000 Sorry, ME is built on the same plain old DOS base that W95 and 98 are. NT, 2000, and XP are the non-DOS versions. Also, the P4 is not well designed for speed with 16-bit applications, from what tests I've seen. Return it for am Athlon-based system, you'll get more bang for your buck. ;-) David gnome@hawaii.rr.com On 23 May 01 at 21:35, Jim Shaffer, Jr. wrote: > > Is there an intrinsic limit to the speed of Fractint? Or might there be an > inhibiting incompatibility with Windows > > ME such that I would get more speed by loading Windows 95 (or 98)onto the > computer? > > Strictly a guess here, but I've heard that ME is a new > operating system with a DOS *emulator* rather than being > built on top of DOS like the older versions of Windows. > If that's the case, maybe Fractint calls some routine > which is particularly poorly-implemented. Or maybe the > ME DOS-emulation display drivers are poorly-implemented. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Guy Marson Subject: Re: (fractint) high speed generation Date: 24 May 2001 14:05:48 +0200 At 21:35 23/05/01 -1000, you wrote: >Sorry, ME is built on the same plain old DOS base that >W95 and 98 are. NT, 2000, and XP are the non-DOS >versions. > >Also, the P4 is not well designed for speed with 16-bit >applications, from what tests I've seen. Return it for am >Athlon-based system, you'll get more bang for your buck. >;-) that's all right!! 2.5 years ago, I made many tests with a 1.44 MB (bootable) floppy disk, DOS 6.22, and Fractint (ver 18.2, 995kb only ;-) ) on it, stick it into many PCs (in PC Shops) and let it run (the autoexec.bat started fractint in batch-mode). The results (running times) are saved into the tstxxx.gif, on the same floppy (video=f3, because of the minor file space). Analysing the tests at home.. (max. 14 tstxxx.gif's per floppy) and as result I got an Athlon K7/600 (the best one of that time, it needs 1.95' for the test.gif). The today developpers-version 20.1.10 needs only 1.43'. Here is the .par of the test file.. (try video=f3). If someone is interested into all the files, let me know.. test {; ex swirl.par.. reset=1820 type=mandel center-mag=-0.74909880336762710/+0.05084338424079404/1.304918e+012 params=0/0 float=y maxiter=9000 inside=0 logmap=2178 periodicity=0 viewwindows=1.8/0.75/yes/0/0 colors=000zI0<2>z00<3>m06j07g09<3>W0ET0FP0HM0II0K<3>809506303000<6>21H21\ J31L<3>42V42Y52_<3>63i69i5Gh4Mf<3>2Zb2ab2ca<3>1k_1mZ0oZ0qY0rX0tX0vX0vX<1\ 6>8KG9HF9FE9CDAAC<2>B39C08C09<3>G0GH0II0KL0JO0HS2GV0E<3>h08l06o05<2>z00<\ 4>zT0zY0zc0<2>zt0yy0zu0<3>zZ0zT0zN0<3>z00<3>m06j07g09<3>W0ET0FP0HM0II0K<\ 3>90B708506303000<2>01612913B14D14F<6>39V3AX3BZ<2>4De5Eh4Kg4Of3Sd<3>2ba2\ e`1g`<3>1oZ0pY0rY0tX0vW0vX<16>0KB0H90F80C70A6<2>032000202<3>B0CD0FG0HI0K\ <4>Z0Da0Ce0A<2>o05s04w01y00<3>yN0zS0zY0<3>zt0yy0zu0<5>zN0 } cheers, Guy Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 24-05-01 (Fragmented Fractal [5]) Date: 24 May 2001 08:39:03 EDT Classic FOTD -- May 24, 2001 (Rating 5) Fractal visionaries and enthusiasts: The day was supposed to be slow, but unfortunately the customers didn't get the message, so here I am, writing at 7:45 the next morning. No problem however. I've now got at least an hour to spare. Today's image is average, so I gave it an average rating of 5. I named it "Fragmented Fractal", a name that accurately describes the scene. The fragmentation is not unusual however, as all fractals created by formulae with fractional powers of Z are fragmented. But thanks to the coloring, today's scene has more of a feeling of depth than most. While studying the image, searching for a name, I got the feeling of staring down into the imaginary depths of mathematical hyperspace, watching the bits and pieces swirl and change shape. An animation would show this effect far better, but there is no time to create animations at a one-a-day rate. The parameter file renders in 16 minutes on a basic Pentium-I running at 200mhz. The GIF image will soon be available on the internet at: and at: The fractal weather today made up for yesterday. The clear blue sky, light winds, and temperature of 77F (25C) gave the cats no reason to complain. They spent the afternoon in the yard, wishing they were young enough once again to run and climb all day. I'll take it up from here in the next FOTD, on this same list. Right now, duty is calling. It's time to pack away the fractal stuff until tomorrow, feed the cats, and get busy on other things. Until next time, take care and take lots of fractals -- they're rich in isoflavones. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Fragmented_Fractal { ; time=0:16:46.62--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotBC1 function=floor passes=1 center-mag=-0.17750380430011240/+0.265756365793003\ 70/2.139322e+007/1/-130 params=2.289428485/0/-29/0 float=y maxiter=5000 inside=0 logmap=320 periodicity=10 colors=00000P00P00N00N00L00L00L00J00J00H00H00J00H0\ 0H00G00G00E00E00E02C04C04A06A0882A84C84C66E68G48H4\ AJ2CJ2CL2EN0GP0GR0HR0JT0JV0LX0NZ0NZ0P`0Rb0Rd0Te0Ve\ 0Vg0Xi0Zk0Zm0`m0bo0bq0ds0eu0eu0gv0ix0iz0kz0mz0mz0o\ z0qz0qz0sz0uz0uz0vz0vz0sz0qz0oz0kz0iz0gz0dz0bz0`z0\ Zx0Vv0Tu0Rs0Nq0Lo0Jo0Hm0Ek0Ci0Ag06e04d02b00b00`00Z\ 00X00V00T00R00P00R00R00R00R00R00R20R20R40R60R60T82\ TA4TA6TC8TEATECTGETHGTJHTJHVLJVNLVNNVPPVRRVRTVTVVV\ XVVZVXZXZ`XZbX`dXbeXdgXdiXekXgmXgoXioZkqZksZmuZovZ\ oxZqzZszZszZuzZvzZvzVxzTxvRxuNxsLzoJzmHziEzgCzeAzb\ 8z`4zZ2zV0zT0zP0zN0zL0zH0zG0zC0zA0z80z40z20z00z20z\ 20z20z20z40z40z40z40z40z60z60z60z60zA0zE0zH0zL0zP0\ zT0zV0xX0xZ0x`0xb0xd0ve0vg0vi0vk0vk0uk0uk0uk0uk0uk\ 0sk0sm0sm0so0so0qq0qq0qs0qs0qu0ou0ov0ov0ox2ox2mz2m\ z4mz4mz4mz6kz6kz6kz8kz8kz8izAizAizAizAiz8kz8kz8kz8\ mz8mz8mz8oz8oz8oz8qz8qz8q } frm:MandelbrotBC1 { ; by several Fractint users e=p1, a=imag(p2)+100 p=real(p2)+PI q=2*PI*fn1(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z| Subject: Re: (fractint) high speed generation Date: 24 May 2001 23:20:03 -0400 ------=_NextPart_001_0000_01C0E4A8.104A0920 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable >Or maybe the ME DOS-emulation display drivers are poorly-implemented. Try comparing Fractint on the 2 machines in disk-video mode. That removes= the effects of video drivers on the speed. It should be at least 4x fast= er on the newer box, just comparing megahertz -- more when the benefits o= f more modern caching enter the equation, and more still if you got hold = of a version optimized for the newer machine.

Get Your= Private, Free E-mail from MSN Hotmail at
http://www.hotmail.com.

------=_NextPart_001_0000_01C0E4A8.104A0920 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
>Or maybe t= he ME DOS-emulation display drivers are poorly-implemented.
Try comparing Fractint on the 2 machines in disk-video mode. That remov= es the effects of video drivers on the speed. It should be at least 4x fa= ster on the newer box, just comparing megahertz -- more when the benefits= of more modern caching enter the equation, and more still if you got hol= d of a version optimized for the newer machine.
<= BR>

Get Your Private, Free E-mail from MSN Hotmail at = http://www.hotmail.com.

------=_NextPart_001_0000_01C0E4A8.104A0920-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: Re: (fractint) C-FOTD 22-05-01 (Shadows [6]) Date: 25 May 2001 12:28:58 -0000 >From: Jim Muth >Reply-To: fractint@lists.xmission.com >To: fractint@lists.xmission.com >CC: philofractal@lists.fractalus.com >Subject: (fractint) C-FOTD 22-05-01 (Shadows [6]) >Date: Tue, 22 May 2001 10:20:08 -0400 (EDT) > > >Classic FOTD -- May 22, 2001 (Rating 6) > >Fractal visionaries and enthusiasts: I'm sorry, I have to reply this time:- That image is trriiiiippppyyy! I like it! I don't know how you calibrate *your* scale of fractal worth (apparently to give a uniform distrobution!), but on *my* scale that rates an 8! Thanks. Andrew. _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: Re: (fractint) C-FOTD 23-05-01 (Simply Wonderful [9]) Date: 25 May 2001 12:33:27 -0000 >From: Jim Muth >Reply-To: fractint@lists.xmission.com >To: fractint@lists.xmission.com >CC: philofractal@lists.fractalus.com >Subject: (fractint) C-FOTD 23-05-01 (Simply Wonderful [9]) >Date: Tue, 22 May 2001 23:50:28 -0400 (EDT) > > >Classic FOTD -- May 23, 2001 (Rating 9) > >Fractal visionaries and enthusiasts: [snip] >frm:MandelbrotBC1 { ; by several Fractint users [snip] ...and then I read the next message in my inbox and find this, an image rated at 9, *desirving* a 9, and made with the formula I help to create. I know exactly what *I* like about this image... it's the colours. Very nice. And the shapes remind me of leopard skin... Thanks. Andrew. _________________________________________________________________________ Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 25-05-01 (Chaotic Toyland [6]) Date: 25 May 2001 10:27:49 EDT Classic FOTD -- May 25, 2001 (Rating 6) Fractal visionaries and enthusiasts: With today's image we return to the most prolific of all formulae -- the MandelbrotMix4. This formula automatically initializes Z to a critical value and plots the corresponding Mandelbrot plane, an action which produces images filled with Mandeloid midgets of almost limitless variety. The formula 2(Z^(-0.875))+0.02(Z^(-18))+(1/C) drew the image, which was rendered with the outside set to . The parent fractal appears as a crescent island with a large Mandel-bay on the west shore and mini bays stretching along the shore from southwest to southeast. Today's midget is located a short distance inland of the southeast coast. I named the image "Chaotic Toyland", a name with a slightly sinister sound, which matches the vaguely unpleasant image. I rated it a somewhat conservative 6. The attached parameter file renders in under 5 minutes, while the GIF file downloads in less than half that time. In an hour or so, the GIF file will be posted to: and to: Rating the FOTD images brings up a curious point of statistics. When I rate my FOTD's, I compare them with only my previous FOTD's. How then, can my average image be above average? If my average image gets better, the average itself gets better. In Lake Wobegon it is possible for every child to be above average, but such politically correct thinking will not work with fractals, because fractals exist in Fractal Land, which is far more dependent on accurate math. Of course, if I compared my images to all the images created by all the fractalists of the world, every FOTD could be above average. However, that would not be politically correct. My humility prevents me from admitting that I am the world's best fractalist. ;-) The fractal weather was once again ideal for the pair of intrepid cats, who spent the afternoon enjoying the sunny skies and temperature of 77F (25C). When they finally came indoors I treated them to a dish of tuna fish. It's now time to open up the fractal shoppe and begin the day's work. Until next time, take care, and think critically about your fractals. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Chaotic_Toyland { ; time=0:04:40.44--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotMix4 function=recip passes=1 center-mag=-1.39890905931845/-1.978045199630535/1.\ 065885e+009/1/-60 params=2/-0.875/0.02/-18/0/800 float=y maxiter=750 inside=0 outside=tdis logmap=yes periodicity=10 colors=000Y5zb5z`5z`5z_5v_5rY5nY5iW5fW5bW5PW5CWF0b\ 5RDP`ARW9ST7SP6UK4WH2WD0Y90Y60_20`00`00b00d00d00e0\ 0e04_0KU0bP0nK7pIAmHCiFFfFHbEK`CMYBNVBRR9TN7WK5YI5\ _H5bH5fF5gF5kD5mD5pC5tC5vA5yA5z95z95z75z75z75zC5zF\ 5zK5yN5vT5pW5k`5fd5bi5Ym5Tp5Pr5Mr5KrBItHFtNDtSCv_A\ ve7vk6xr4xx2xx0yx0yx0yx0xx0vx0vx2tx4ts6rn9riApbCpY\ FnSHnNIiSFfWDb_CYbAVe9Rk7Mn6Ir2Fu0Ax07x04x00x00x00\ x09x7NxMbxTmxUywNwrMumKshKqcIoZImVHmSHmNFmHFmBDm5D\ m5Co5Cq5As5Au5Iw5RxB_xIgxSpxbyxkzzqzzvzzxzyxzxuztr\ zrnxpktmgnkdki`fgYbbWbYUbTSbNR`IP`DN`9M`4K`0I`0HW0\ FT0FP0EM0CI0CF0BA0970040000000000000040590AD0BI0CN\ 0ET0EY0Fb0Fg0Hm0HrNSzTRzWPz_NxbMpfKkiIdmHYpFRtEMxC\ FzB9z92z90vI0iR2_`4Ni6Cr92xA0xC0xD0xI0xM0xP0sT0nW4\ g_7`bAWfFPiIKmMEpP9tNCtNExNFtNHzMKzMMzMNzMPzKSzKUz\ KWzKYzI`zIbzIdzIezPYzVPz`HzfBz`EzYFzVIzPKzMMzIPzDR\ zAUz7Wz2Yz0`z0bz0dz`bzb`z } frm:MandelbrotMix4 {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j, k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < l } END 20.0 PAR-FORMULA FILE================================== Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 26-05-01 (4th root of Two [6]) Date: 26 May 2001 09:49:15 EDT Classic FOTD -- May 26, 2001 (Rating 6) Fractal visionaries and enthusiasts: When I discovered the Mandelbrot set some 16 years ago, the most fascinating thing about it was the existence of countless midget sets, no two midgets exactly the same, (except for the mirror- image symmetry around the X-axis). I have never really recovered from my fascination with these midgets. Probably nine of ten of my FOTD's feature a midget at the center, usually a midget of the quadratic variety. But midgets come in many varieties other than quadratic. Today's midget for example exists in a remote part of the fractal created by the formula Z^(sqrt(sqrt(2)))+C. Down in this low range there is no standard shape for the midgets, which come in all shapes. In this case, the colorful pattern surrounding the midget resembles a butterfly or moth. The midget itself, where its border is not defined by one of the discontinuities, has an ill-defined shoreline, with several tiny bays, which closer examination reveals to be totally chaotic. These chaotic shorelines exist in most midgets of a low order between 1 and 2, and are not fully revealed until the maxiter reaches a very high value. The maxiter of today's image is 75,000, and even this could be raised. I tried the image at a maxiter of 150,000, which sharpened the shoreline slightly, but it also made the render time inordinately long and buried too much of the color range right along the shoreline. I named the picture "4th root of Two" and rated it a 6. With a render time of almost 20 minutes, the parameter file is a slow one, making a download of the GIF image file by far the better choice. The image file will soon be posted to: and: The fractal weather today was cloudy and 74F (23C). The atmosphere was very unsettled all afternoon, with heavy thunder- storms and a tornado in the area. Fractal Central escaped the worst of it, though the heavy rain kept the cats well under cover. I now hear Tippy calling for his morning snack, so I guess it's time to turn my attention to more pressing matters and get some food into him. When Thomas sees Tippy eating, he'll turn hungry also, and rush to the dish to keep Tippy from getting all the food. The philosophy is simmering and could erupt at any moment, so stay tuned. But for now, and until next time, take care, and having a second cat is the best way of getting the first cat to eat his food. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ 4th_root_of_2 { ; time=0:19:56.88--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotBC1 function=floor passes=t center-mag=-1.311059032031873/+10.1354130773853/50\ 793.51/1/114.999 params=1.189207115/0/240/3500 float=y maxiter=75000 inside=0 logmap=67 periodicity=10 colors=000A0AA0AA0AA1AA2AA3AA4AB5AE6AH7AJ8AM99PA8R\ B8UC7XC6_D5ZC6YC7XC8WC9VC9UCATBBSBCSBCRBCQBBPBAOA9\ NA8KA7GA6AA0070AA0PDAYFKdINkLPrKRqNQpPQoRPnTPnVOmX\ Ol_OkaNjcNjeMigMhiLglLfnLfpKerKdtJcvJcxJfoPigVl_`o\ RerJkuBqz1xx3vw4uv6tt7ss8rrApqBooDnnEmmFlkHjjIiiJh\ hLgfMfeOddPcbQbaSa`T`_U_YSYXRXWQVVOUUNTTMRSKQRJPQI\ NPGMOFKNEJMCILBGKAFJ9EMCGPEHSGIVJKXLL_NMbPNeSPhUQj\ WRmZTp`UsbVudWrfUohSljQilOfnMcpK`rIYtGVvETwDRvCQuC\ PtCOsCNsCMrCKqCJpCIoCHoCGnCFmCDlCCkCBkCAjC9iC8hC5n\ A7hC9cDAYECUFDUGFUHGUIIUJJUKIUQHUVGU_GUdFUjEUoDUtD\ UyBUvAUs9Up7Vm6Wj5Xh6Yg7Zf8_f9`eAadBbdBccCdbDebEfa\ Fg`Gh`Hi_HjZIkZJlYKmXLnXMoWNpVLqUNrVOsVQtWRuWTvXUw\ XVxYXyYYzZ_zZ`z_az_cz`dz`fzagzahzabzE`zG_zHYzJXzKW\ zMUzNTzPRzQQzSPzTNzVMzWKzYJzZIz`GzaFzcDzdCzfBzg9zi\ 8zj7zkDzlIzmNznSzoXzpbzqgzrlzsqztvzuuzrtzotzlszj5z\ b6z`6zZ6zY7zW7zU8zS8zQ9zO } frm:MandelbrotBC1 { ; by several Fractint users e=p1, a=imag(p2)+100 p=real(p2)+PI q=2*PI*fn1(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z| Subject: (fractint) From a real meddler Date: 26 May 2001 23:16:48 +0100 This is a multi-part message in MIME format. ------=_NextPart_000_002B_01C0E639.F00A38E0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable The colors=3D command in a par file is documented with the words 'This = form of the=20 COLORS=3D command is not intended for manual use....'. In other words = 'keep your=20 prying nose out Chris'. I would quite like to generate a colors=3D = section from a=20 colour editor I'm struggling with; the compact form appeals to my = old-fashioned=20 sense of saving space (about 750 bytes vs 3 - 4Kb .map files). So, = being a born=20 meddler, I've been trying to 'suss out' the syntax. 0-9, A-Z, _ , `, and a-z I've got. I assume that ABC<14>XYZ is a 16 = entry linear ramp=20 between ABC and XYZ but how to explain HHH<9>HHH<4>HHH, why not = HHH<14>HHH ? Is this an area of arcane knowledge and deep secrets or can someone = enlighten me? :-D Chris Curnow ------=_NextPart_000_002B_01C0E639.F00A38E0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
The colors=3D command in a = par file is=20 documented with the words 'This form of the
COLORS=3D command is not = intended for=20 manual use....'.  In other words 'keep your
prying nose out Chris'. =   I would=20 quite like to generate a colors=3D section from a
colour editor I'm struggling = with; the=20 compact form appeals to my old-fashioned
sense of saving space (about = 750 bytes vs=20 3 - 4Kb .map files).  So, being a born
meddler, I've been trying to = 'suss out' the syntax.
 
0-9, A-Z, _ , `, and a-z I've = got. =20 I assume that ABC<14>XYZ is a 16 entry linear ramp
between ABC and XYZ but how = to explain=20 HHH<9>HHH<4>HHH, why not HHH<14>HHH ?
 
Is this an area of arcane = knowledge and=20 deep secrets or can someone enlighten me? :-D
 
Chris = Curnow
------=_NextPart_000_002B_01C0E639.F00A38E0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul N. Lee" Subject: Re: (fractint) From a real meddler Date: 27 May 2001 00:04:50 -0500 Chris Curnow wrote: > > 0-9, A-Z, _ , `, and a-z I've got. Here is a web page I threw up sometime ago: http://home.att.net/~Paul.N.Lee/Palette.html > > I assume that ABC<14>XYZ is a 16 entry linear > ramp between ABC and XYZ.... Yes, they are linearly interpolated to condense and save space, as in the following example: zS_<2>zMO = zS_zQWzOSzMO R G B ------------- zS_ = 252 112 144 zQW = 252 104 128 zOS = 252 96 112 zMO = 252 88 96 > > but how to explain HHH<9>HHH<4>HHH, why not > HHH<14>HHH ? Curious, never seen one like that before, but never looked for one either. :-) Sincerely, P.N.L. http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Multiple Bogeys" Subject: Re: (fractint) From a real meddler Date: 27 May 2001 07:23:58 -0400 ------=_NextPart_001_0000_01C0E67D.FF2FD840 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable I reverse-engineered the format ages ago. If the Fractint color editor ge= nerates HHH<5>HHH<4>HHH, it's gonna do the same thing read back in as HHH= <10>HHH -- as for why the editor writes out the less-efficient form, it m= ost likely thought there was a "bend" at the middle HHH that isn't really= there. A likely cause is that it stores the color components internally = as 8 bit values, whereas only the six most significant bits produce a dif= ferent actual color or colors=3D symbol. The extra low precision bits tha= t are discarded are causing these oddities. A more insidious effect is that these bits *do* alter the colors you see = in a subtle way. If you use the color editor to interpolate a gradient, t= he extra bits in the representations of the end-points affect exactly whe= re the components change over along the gradient -- that is they affect s= ignificant bits of the interpolated values. When the gradient is written = out to a par file, the extra bits are discarded from the endpoints, and w= hen the gradient is read back in, the colors are slightly different. This= , in turn, led to the recent introduction in a developer patch of the opt= ion to not compress colors in par files (which option is obsolete anyways= , with typical modern disk capacities). This writes out the colors comple= tely without the shortcuts, producing (for a 256 color mode) a 768-b= yte palette data sequence; colors=3DXYZWAB... with 256 triplets. This probably also contributes to some of the strange color changes obser= ved sometimes importing into UF. Other such changes seem to result from l= osing artifacts of integer math or other algorithm artifacts.

Get Your Private, Free E-mail from MSN Hotmail at
http://www.hotmail.com.

------=_NextPart_001_0000_01C0E67D.FF2FD840 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
I reverse-engineered the format ages ago. If the Fractint colo= r editor generates HHH<5>HHH<4>HHH, it's gonna do the same th= ing read back in as HHH<10>HHH -- as for why the editor writes out = the less-efficient form, it most likely thought there was a "bend" at the= middle HHH that isn't really there. A likely cause is that it store= s the color components internally as 8 bit values, whereas only the six m= ost significant bits produce a different actual color or colors=3D symbol= . The extra low precision bits that are discarded are causing these oddit= ies.
 
A more insidious effect is that these b= its *do* alter the colors you see in a subtle way. If you use the color e= ditor to interpolate a gradient, the extra bits in the representations of= the end-points affect exactly where the components change over along the= gradient -- that is they affect significant bits of the interpolated val= ues. When the gradient is written out to a par file, the extra bits are d= iscarded from the endpoints, and when the gradient is read back in, the c= olors are slightly different. This, in turn, led to the recent introducti= on in a developer patch of the option to not compress colors in par files= (which option is obsolete anyways, with typical modern disk capacities).= This writes out the colors completely without the <nn> shortcuts, = producing (for a 256 color mode) a 768-byte palette data sequence; colors= =3DXYZWAB... with 256 triplets.
 
This probabl= y also contributes to some of the strange color changes observed sometime= s importing into UF. Other such changes seem to result from losing artifa= cts of integer math or other algorithm artifacts.



Get Your Private, Free E-mail from MSN Hotmail a= t http://www.hotmail.com.

<= /DIV> ------=_NextPart_001_0000_01C0E67D.FF2FD840-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 27-05-01 (Arachnid [5]) Date: 27 May 2001 10:11:33 EDT Classic FOTD -- May 27, 2001 (Rating 5) Fractal visionaries and enthusiasts: While studying today's image, I had the impression of an alien spider crawling across the screen. I immediately named the image "Arachnid". Then the time came to rate the image. I first decided to settle on a 6, but then I left the screen for a few minutes. When I returned, I noticed how closely the colors resemble the terrible Fractint default palette, and settled for an average 5. The scene of today's FOTD is located in a valley in remote part of the infinite Z^sqrt(2)+C fractal, about 29 turns down the logarithmic spiral. The parameter file takes about 1/4 hour to finish -- long enough to make the trip to Paul's web site at: or Scott's site at: to download the GIF image worth the effort. The fractal weather featured heavy rain all day, which led to a flood in the fractal basement. All this was climaxed by some noisy thunder-storms that passed over after nightfall. The fractal cats disapproved most strongly, not only of the rain and noise, but also of the temperature, which never rose above 63F (17C). Such a temperature is simply too chilly for two intrepid fractal cats. And until tomorrow at this same time, I'm out of here. Take care, and watch out for that computer -- it may be observing you while you observe it. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Arachnid { ; time=0:15:34.17--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotBC1 function=floor passes=1 center-mag=-1.193364087424675/+0.4048602099941181/\ 1.235979e+007/1/-35 params=1.414213562373/0/-29.3/0 float=y maxiter=4000 inside=0 logmap=460 periodicity=10 colors=000F0ZF0ZF0aF4eF8hFCkFGnFIqDIt7Iv1Iy0Kz0Kz0\ Kz0Ky0Kx1Kv4Kv7KuAKsCKrFKpIKpLKoOKmQGlTCjV7j`AfdDc\ jF`oIYuLVyMSzPPzQMzOLzMLzLLzJLxILvGLuDJrCJpAJm9Jl7\ Jj9JgAIdCG_DFXCDTACQ9AO79L67I46I34L13O04Q06T16X47_\ 79aAAdCAgFCjIDmLFpOFsQGvTIyVIvYLu_Os`PpaSocTmdXjfY\ ig`giaid_iaYj_VjXTjSSlPPlMOlJMdVOYfOVgQSiTPjVOlYLm\ `IoaFpdDrfAsi7ul4vm5xpAysFzuKzxPzyUxxZsxcoxcivcgvc\ evccucauc_ucYrcWpcUocSmcQjcOicLgcIfcFcc0a`0`Z0_U0Y\ 40S44O4AJ4FF3L93P43V03_03c0Aa0G`0M_0SY3YX6dV9jTCpS\ FvQIzPJxTMuXOr_PmcQjfSgiTdlV`pXYsYVv_Sy`OzaLzcIzdF\ zfDzlCzpAzv9zz9yzCszDovFjrIfmJaiLXdOS`POXQJSSFPM9I\ G3CC06600100600A00F00J30O70SC0XG0_L0cP0gT0lY0pa0uf\ 0yj0zo0zr0zl0zg0zc3z_6zT9zPCzLFzGIzCLzGOzLQzPTzTXz\ Y`zaczffzjizolzspzxszzvzzyzzzzzuyzmxzfvz_uzTszMrzF\ pz7oz0mz0VzGDz`IzaMzaQzaVzc_zcczcgzdlzdpzdrzXszOuz\ Fvz6vz0zzAzzMzzYzzizzspzf } frm:MandelbrotBC1 { ; by several Fractint users e=p1, a=imag(p2)+100 p=real(p2)+PI q=2*PI*fn1(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z| Subject: (fractint) Using Fractint with a Radeon card Date: 27 May 2001 16:26:07 +0100 I've just tackled a major upgrade which has including installing an ATI Radeon 32 card in my PC. Looking through the video modes included in Fractint, I can't see anything which looks applicable, and only the most basic 16-colour modes seem to work. Can anyone recommend suitable video settings for this card? I've tried running the file which automatically generates a .cgf file, but this crashes before it can create a file. Regards, Doug Richardson Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Chris Curnow" Subject: Re: (fractint) From a real meddler Date: 27 May 2001 21:51:16 +0100 This is a multi-part message in MIME format. ------=_NextPart_000_0023_01C0E6F7.27DBCA00 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable Mutiple Bogeys wrote =20 >This, in turn, led to the recent introduction in a developer patch of = the option=20 to not compress colors in par files (which option is obsolete anyways, = with typical=20 modern disk capacities). This writes out the colors completely without = the =20 shortcuts, producing (for a 256 color mode) a 768-byte palette data = sequence;=20 colors=3DXYZWAB... with 256 triplets. < Paul N. Lee wrote > Here is a web page I threw up sometime ago: http://home.att.net/~Paul.N.Lee/Palette.html < Thanks Paul and Multiple B for the fast response :-) I'm feeling a bit silly now because it's all documented in the 20.1.06 = version=20 help file! (Went looking for the option to supress compression, - can't = find=20 *that* but did find a complete description of the colour specification). Anyway, thanks again Chris Curnow ------=_NextPart_000_0023_01C0E6F7.27DBCA00 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
Mutiple Bogeys wrote 
>This, in turn, led to the recent introduction in a developer = patch of=20 the option
to not compress colors in par files (which option is obsolete = anyways, with=20 typical
modern disk capacities). This writes out the colors completely = without the=20 <nn>
shortcuts, producing (for a 256 color mode) a 768-byte palette data = sequence;
colors=3DXYZWAB... with 256 triplets. <
 
Paul N. Lee wrote
Thanks Paul and Multiple B for the fast response :-)
 
I'm feeling a bit silly now because = it's all=20 documented in the 20.1.06 version
help file!  (Went looking for the = option to=20 supress compression, - can't find
*that* but did find a complete = description of=20 the colour specification).
 
Anyway, thanks again
Chris Curnow
 
------=_NextPart_000_0023_01C0E6F7.27DBCA00-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "David Jones" Subject: (fractint) Re: Using Fractint with a Radeon card Date: 27 May 2001 13:46:39 -1000 You might want to check with your display adaptor manual and see if there's some thing you need to do to enable VESA support. Then, again, it might be like my Elsa GLoria Synergy adaptor - no VESA support, nothing better than 640x480x256. Even after running the famous utility that identifies supported VESA modes. David gnome@hawaii.rr.com On 27 May 01 at 16:26, Doug Richardson wrote: > I've just tackled a major upgrade which has including > installing an ATI Radeon 32 card in my PC. > > Looking through the video modes included in Fractint, I > can't see anything which looks applicable, and only the > most basic 16-colour modes seem to work. > > Can anyone recommend suitable video settings for this > card? I've tried running the file which automatically > generates a .cgf file, but this crashes before it can > create a file. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "David Jones" Subject: Re: (fractint) From a real meddler Date: 27 May 2001 13:46:39 -1000 On 27 May 01 at 0:04, Paul N. Lee wrote: > Here is a web page I threw up sometime ago: No insult intended, but we all had a laugh about that phrasing here! 8-) David gnome@hawaii.rr.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 28-05-01 (Holy Moley [7]) Date: 28 May 2001 10:02:24 EDT Classic FOTD -- May 28, 2001 (Rating 7) Fractal visionaries and enthusiasts: It's a holiday today here in the USA, and I intend on making the most of it. But first, I will produce my FOTD. In addition to enjoying fractals, I also enjoy junky old sci-fi movies and almost-as-junky old comic books. One of my favorite comic heroes from the past is Captain Marvel, AKA Billy Batson, who gets his super powers from a mystic wizard known as Shazam. (There also were various other characters with magical powers in the comic series, but only the captain himself was the real thing.) When the captain spotted the forces of evil in action, (AKA Sivana, the evil scientist), he frequently exclaimed, "Holy Moley!" And when I saw today's fractal, I exclaimed the same thing. I had found the name for today's image. The rating of 7 soon followed. The image is another scene located far down the logarithmic spiral of the Z^sqrt(2)+C fractal. In this case, the area that holds the scene is a tiny fragmented island floating in the main bay. This explains the fragmentary nature of the image. The parameter file renders in 25 minutes. The GIF image downloads in one minute from: or: The choice is up to the viewer. The fractal weather today was sometimes cloudy and sometimes sunny, with a temperature of 74F (23.5C) and a series of heavy thunder-storms in the afternoon and evening. The cats griped and grumbled about the intermittent downpours, but were comforted by occasional treats of tuna. As for me, I'm going to get started early to beat the next round of thunder-storms, which is due to arrive this afternoon. Until later, take care, and fractals bring the peace that defies description. Jim Muth jamth@mindspring.com START 20.0 PAR-FORMULA FILE================================ Holy_Moley { ; time=0:24:55.62--SF5 on a P200 reset=2001 type=formula formulafile=allinone.frm formulaname=MandelbrotBC1 function=floor passes=1 center-mag=-0.35475931415572680/-0.018444369957113\ 51/278173.3/1/155 params=1.414213562373/0/29/0 float=y maxiter=6000 inside=atan outside=tdis logmap=yes periodicity=10 colors=000e00e00e00g11jC6mMCmUHpeMrpSrxYzppzgzzbzz\ UzzPzzSzzSzzSzzUzzUzzUzzYzzYzzYzu_zp_zj_zebz_bzUbz\ PbzMUzMMzKEzK6zH0zH0zE0zE0zC0zC0z90z66z4Sz1mz0zp0z\ b0zS4zPCzMKzKSzK_rHgeEpUExHCz69z09z00z00z00r90gb0Y\ z6MzEUzHbzKjzKrzMzxPzrPzmSzgSzbPz_PzYMzUMxSKrPKmMH\ jHHeEE_CEU9CS6CM49H19E09C1C91E91H61K41M41P11S11U01\ Y04_04b04e04g04j04m04p04r04u06p16m96jE6eM6bU6_b9Yg\ 9Sp9Px9Mz9Hz9EzCCzC9zC4zC1zC0zC0zH4zKCzPKzSSzY_r_e\ gem_guPmzEpz4uz0xz0zz0zz0zz0zz0zz0zz0zz0zz0xz0uz1p\ z9mzJ0K00H01K06K0CP0HS0MU0SU0Y_0bb0gg0mj4pmCurKzuS\ zzbzzjzzrzzzzzzzzzzzxzzrzzpzzjzxezu_zrYzpSzmMzgHze\ Ezb9z_4zU0zS0zP0zM0zK0zE0zC0z90z60z40z60z90zC0zE0x\ H4rHCjKHeMP_PUSSbMSgHUp9Yu4_z0bz0ez0ez0gz0jz0mz0pz\ 0pz0mz0mz0mz0mz0jz0jr6jjEjbKjYSgPYgHeg9mg1rg0ze0ze\ 0ze0ze0ze0zU0zM6pEMb4_S0mE0z40z90zE0zK4zPCzUKz_Sze\ _zjgzppzuxzxzx_zb00b00b00 } frm:MandelbrotBC1 { ; by several Fractint users e=p1, a=imag(p2)+100 p=real(p2)+PI q=2*PI*fn1(p/(2*PI)) r=real(p2)-q Z=C=Pixel: Z=log(Z) IF(imag(Z)>r) Z=Z+flip(2*PI) ENDIF Z=exp(e*(Z+flip(q)))+C |Z| Subject: (fractint) high speed generation Date: 28 May 2001 22:23:36 -0500 This is a multi-part message in MIME format. ------=_NextPart_000_002A_01C0E7C4.D6A64100 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable Thanks to all for helpful comments and suggestions. I might give the = Athlon-based system a try, but for now, I'm glad to be back with my = 300MHz P2, sort of like putting on an old glove. By the way, running = FractInt in disk-video mode was actually slightly slower on both = machines, suggesting that the problem is the heavy optimization of P4 = for 32-bit code rather than the effects of video drivers on the speed. Lee ------=_NextPart_000_002A_01C0E7C4.D6A64100 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable
    Thanks to all for = helpful=20 comments and suggestions. I might give the Athlon-based system a = try, but=20 for now, I'm glad to be back with my 300MHz P2, sort of like putting = on an=20 old glove.     By the way, running FractInt in disk-video = mode=20 was actually slightly slower on both machines, suggesting that the = problem is=20 the heavy optimization of P4 for 32-bit code rather than the effects of = video=20 drivers on the speed.
    = Lee
------=_NextPart_000_002A_01C0E7C4.D6A64100-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@fractint.org Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JimMuth@aol.com Subject: (fractint) C-FOTD 29-05-01 (Illusion [7]) Date: 29 May 2001 10:39:10 EDT Classic FOTD -- May 29, 2001 (Rating 7) Fractal visionaries and enthusiasts: Due to a lengthy letter to the philofractal list, I am a bit late. Today's image has an intriguing name. I named it "Illusion" because the full pinwh